KEGG   Shewanella pealeana: Spea_1382Help
Entry
Spea_1382         CDS       T00606                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
spl  Shewanella pealeana
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:spl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spea_1382
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Spea_1382
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Spea_1382
Two-component system [BR:spl02022]
 CheA family
  CheA-CheYBV
   Spea_1382
Bacterial motility proteins [BR:spl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Spea_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1679983..1681164
Genome map
AA seq 393 aa AA seqDB search
MGIKVLVVDDSSFFRRRVSEIVNQDPELEVVGTACNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVKEIMASKPIPILMFSSLTHDGAKATLEALDAGALDFLPKRFEDIASNKDDAIA
LLQQRIRALGRRRLFRPITRTLSSNDRALSGNERAQSVTDRSRPISSFSRTSVNAPATSG
HSLTASDKPVSRSSVVTRSSGKQYKTLLIGTSTGGPVALQKVLTQFPANYPHPILLIQHM
PAAFTPTFAARLNGLCKIEVKEAVSGDQLRPGCAYLAPGGMQMMLERGGAYGRVKIIAGK
ADMNYKPCVDITFASASKVLGGDVLAVVLTGMGADGREGARMLKSIGATIWAQDEASCVV
YGMPQAVAAAGIATKSIALEHMAESILKETVNG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagttttagtcgttgatgattcgagtttttttagacgacgtgttagtgag
atagtgaatcaagaccctgagcttgaggtggtggggactgcctgtaatggtgcagaggcg
gtgaagatggctgcagagctgaacccgcaagtgatcaccatggatatcgaaatgcctgtc
atggatgggatcactgcggttaaagagatcatggcgagtaagccaattccaatcttgatg
ttttcatcattgacgcacgatggtgctaaggcaacgttagaagcgttggatgccggcgct
ttagatttcttaccaaaacgctttgaagatatcgcaagtaacaaagatgacgctatagcg
ctgttacagcaacgtattcgagcattaggccgccgtcgcttgtttagacccataactcga
acattgtcgagtaacgatagagcgctttcaggcaatgaaagagctcaatctgtcacagat
agatctcgcccaatctcaagtttttctcgaacgagtgttaatgcaccagcaactagcggt
cactcgttaactgctagcgataagcccgtgagtcgttctagtgttgtgacccgtagtagt
ggaaaacaatacaagacgttattaatcggtacctctacaggtgggcctgttgctttacaa
aaggtgttaactcaattccctgccaattatccacatcctattttgcttatccaacatatg
cctgctgcctttacgccaacatttgcggctaggcttaatggcttgtgtaagatagaagtt
aaagaggcggtgagcggagaccagttaaggccgggttgtgcatatcttgcccctggaggt
atgcagatgatgctagagcgaggcggagcctatggcagagttaagatcattgctggtaag
gcggatatgaactacaagccttgtgtcgatattacttttgcctcagcttcgaaggtgctt
ggtggtgatgtgttggccgtagtgctcacgggcatgggagccgatggccgtgaaggggcc
agaatgctcaagagtatcggtgcgaccatttgggcgcaagatgaggccagctgtgtggtt
tatggcatgcctcaagccgtcgcggctgcgggtattgcaaccaaatcaattgcgttagag
catatggctgaatcgattttaaaagagaccgttaatggctaa

DBGET integrated database retrieval system