KEGG   Shewanella pealeana: Spea_1447Help
Entry
Spea_1447         CDS       T00606                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spl  Shewanella pealeana
Pathway
spl00040  Pentose and glucuronate interconversions
spl00052  Galactose metabolism
spl00500  Starch and sucrose metabolism
spl00520  Amino sugar and nucleotide sugar metabolism
spl01100  Metabolic pathways
spl01130  Biosynthesis of antibiotics
Module
spl_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spea_1447
   00052 Galactose metabolism
    Spea_1447
   00500 Starch and sucrose metabolism
    Spea_1447
   00520 Amino sugar and nucleotide sugar metabolism
    Spea_1447
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spea_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABV86772
JGI: Spea1447
UniProt: A8H2I5
Position
complement(1760970..1761878)
Genome map
AA seq 302 aa AA seqDB search
MKQHKIRKAVIPVAGLGTRMLPATKAIPKEMLPVMDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSVENHFDTSFELETQLERRVKRQLLAEVQAICPADVTIISVRQSQAKGLGHAILCA
KSIIGDAPFAVLLPDVLIDDASSDLTKENLADMVALYNQTEVGQIMVEGVPHELVNQYGI
ADINGAELKPGESLPLTQLVEKPSIEDAPSNLAVVGRYVLPAEIWSYLAKTPAGAGDEIQ
LTDAIAMLMENQTVNAYYMQGKSHDCGNKLGYMQAHVEHALRHKEIGSEFAEYLKAIVKT
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataaaattcgcaaagcagttatccctgtagcaggccttggaactcgaatg
cttccagccaccaaagctatcccaaaagagatgctgccggttatggacaaaccactgatc
cagtatgttgtcagcgaggctatcgctgcgggaattaaagaaattgtcttagtcactcac
gccagtaagaactcagttgaaaaccatttcgataccagctttgagttagagactcagctc
gagcgtcgcgttaaacgtcaactattggccgaagtacaagccatttgcccagctgacgtc
accattatcagtgtacgtcagtcacaagctaagggcttaggtcacgcaattttatgcgca
aaaagcatcataggtgacgccccctttgccgtactactaccagatgtactgatcgatgat
gctagtagcgatctaactaaagaaaatcttgccgatatggttgccctttataatcagact
gaagttggccaaatcatggttgaaggcgtccctcatgagcttgttaaccagtacggtatt
gccgatattaatggtgcagagctcaagcctggtgagtcactgccacttactcagctggta
gagaaaccaagtattgaagatgcaccatctaacttagccgttgtaggccgctatgtgtta
ccagccgaaatctggtcatatctagctaagacaccagcaggggccggtgatgaaatccag
ctcactgacgcaattgctatgttaatggaaaaccaaaccgtcaatgcatattacatgcaa
ggcaagagtcatgactgcggtaataaattaggttatatgcaagctcatgtagagcatgct
ctgcgtcataaggaaattggctcagaattcgctgaatacctcaaagctatcgttaagaca
cttaagtaa

DBGET integrated database retrieval system