KEGG   Shewanella pealeana: Spea_1447Help
Entry
Spea_1447         CDS       T00606                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spl  Shewanella pealeana
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spea_1447
   00052 Galactose metabolism
    Spea_1447
   00500 Starch and sucrose metabolism
    Spea_1447
   00520 Amino sugar and nucleotide sugar metabolism
    Spea_1447
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spea_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1760970..1761878)
Genome map
AA seq 302 aa AA seqDB search
MKQHKIRKAVIPVAGLGTRMLPATKAIPKEMLPVMDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSVENHFDTSFELETQLERRVKRQLLAEVQAICPADVTIISVRQSQAKGLGHAILCA
KSIIGDAPFAVLLPDVLIDDASSDLTKENLADMVALYNQTEVGQIMVEGVPHELVNQYGI
ADINGAELKPGESLPLTQLVEKPSIEDAPSNLAVVGRYVLPAEIWSYLAKTPAGAGDEIQ
LTDAIAMLMENQTVNAYYMQGKSHDCGNKLGYMQAHVEHALRHKEIGSEFAEYLKAIVKT
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataaaattcgcaaagcagttatccctgtagcaggccttggaactcgaatg
cttccagccaccaaagctatcccaaaagagatgctgccggttatggacaaaccactgatc
cagtatgttgtcagcgaggctatcgctgcgggaattaaagaaattgtcttagtcactcac
gccagtaagaactcagttgaaaaccatttcgataccagctttgagttagagactcagctc
gagcgtcgcgttaaacgtcaactattggccgaagtacaagccatttgcccagctgacgtc
accattatcagtgtacgtcagtcacaagctaagggcttaggtcacgcaattttatgcgca
aaaagcatcataggtgacgccccctttgccgtactactaccagatgtactgatcgatgat
gctagtagcgatctaactaaagaaaatcttgccgatatggttgccctttataatcagact
gaagttggccaaatcatggttgaaggcgtccctcatgagcttgttaaccagtacggtatt
gccgatattaatggtgcagagctcaagcctggtgagtcactgccacttactcagctggta
gagaaaccaagtattgaagatgcaccatctaacttagccgttgtaggccgctatgtgtta
ccagccgaaatctggtcatatctagctaagacaccagcaggggccggtgatgaaatccag
ctcactgacgcaattgctatgttaatggaaaaccaaaccgtcaatgcatattacatgcaa
ggcaagagtcatgactgcggtaataaattaggttatatgcaagctcatgtagagcatgct
ctgcgtcataaggaaattggctcagaattcgctgaatacctcaaagctatcgttaagaca
cttaagtaa

DBGET integrated database retrieval system