KEGG   Shewanella pealeana: Spea_1539Help
Entry
Spea_1539         CDS       T00606                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
spl  Shewanella pealeana
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spea_1539
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Spea_1539
Enzymes [BR:spl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spea_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1873763..1874830
Genome map
AA seq 355 aa AA seqDB search
MCFLSFARLDFQEIKNLEGYMSYLMLDIESTELSATESSQLTHPMIGGLILFSRNYVSRT
QLITLIKSIRAIRPDILIAVDHEGGRVQRFREGFTVLPAMGDILPAAKGDMTQAKSWATE
LGYLMAIELLAVDIDLSFAPVLDLNGVSQVIGTRSFSPDKGEVAELASAFIDGMEQAGMC
AVGKHFPGHGSVEADSHIAKPVDERTQDEIFANDMQPFKTLIAKDRLQGIMPAHVIYPKV
DSQPAGFSPFWLQEVLRKQLAFNGVIFSDDLGMKGAAVAGGYTARAQAALDAGCNMILVC
NDSRGATEVLDGVNWPSEDQGLSASLLKPDQSRVAKALEDSARWERAMAIAQSLI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttttaagttttgctaggttagattttcaagagattaaaaatttagagggttat
atgagttatttgatgttagatatcgagtcaacggagctgagtgctacggaatcatcgcag
ttaactcatcccatgataggcggcttaattttgtttagtcgtaattatgtcagcaggact
cagttaatcaccctcattaagtcaatacgcgctattcgccctgatattctgattgcagtc
gatcatgaaggtggcagagtgcaacgctttcgagaagggtttactgtgttacctgcaatg
ggagatattcttcctgcagccaaaggagatatgacgcaggccaagagctgggctaccgag
ctaggttacttgatggcgatagaactgcttgctgttgacatcgatttaagcttcgcgccg
gtattggatttaaacggtgttagccaagtgataggcactagaagtttcagccctgacaag
ggggaggttgccgagcttgctagtgcttttattgatggcatggagcaagcgggtatgtgt
gccgtgggtaagcattttccagggcatggtagcgttgaagccgactctcatattgctaag
ccggttgatgaacgtactcaagatgagatttttgccaatgatatgcagccgtttaaaacc
ttaatcgctaaagaccgtttacagggcatcatgccagcgcatgtgatttatcctaaggtg
gatagccagcctgcaggtttttctccattttggctacaagaggtactgcgtaagcagcta
gccttcaacggcgtcattttctccgatgacttaggtatgaaaggagcggcagtggccggt
ggttacacggctagagcgcaggcagcactcgatgccggttgtaatatgattctagtttgt
aacgatagccgcggagcgactgaggtgttagatggcgttaattggccctctgaagatcaa
ggcttgagtgctagcctgttaaaaccagatcagagccgagtggccaaggccttagaagac
agcgctcgctgggagcgggctatggccatcgctcaaagtttgatttag

DBGET integrated database retrieval system