KEGG   Shewanella pealeana: Spea_1585Help
Entry
Spea_1585         CDS       T00606                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spl  Shewanella pealeana
Pathway
spl00260  Glycine, serine and threonine metabolism
spl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01130  Biosynthesis of antibiotics
spl01230  Biosynthesis of amino acids
Module
spl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spea_1585
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spea_1585
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spea_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABV86910
JGI: Spea1585
UniProt: A8H2X3
Position
complement(1923342..1924151)
Genome map
AA seq 269 aa AA seqDB search
MSQRYQAAFAALNEKQQGAFVPFVTLGDPSPELSLKIIDTLVENGADALELGFPFSDPLA
DGPVIQGANLRSLAAGTTPTQCFEMLTAIRAKYPDLPIGLLLYANLVFANGIDTFYAKCQ
AAGVDSVLIADVPVEEAAPFIESAKAHGVCPIFIAPPNADSETLKQVSEKGEGYTYLLSR
AGVTGTESKAGMPISDILNRLKEFNGAPPLLGFGIAEPSQVKAAIDAGAAGAISGSAVVK
IIEANKDNEAALLSALAEFTRNMKAATAR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacgttaccaggcagcctttgccgccctaaatgagaaacagcaaggcgcattt
gtgccattcgtgaccttaggcgatccatcgcctgagctatcacttaaaatcatcgacacc
ttagttgaaaacggtgccgacgccctagagctcggcttcccgttttcagatccgctcgcc
gatggcccggttattcaaggcgctaacctacgctctttagctgctggcactacaccgact
cagtgctttgaaatgctcacggctattcgagctaaatatcctgacttaccgattggccta
ctactgtacgccaatttagtgttcgccaatggcatcgataccttctacgccaaatgccaa
gccgctggcgttgactcggtactgattgccgatgtgccagtagaggaagcagcaccattt
atcgaatcggcaaaagcccacggcgtgtgcccaatctttatcgcgccgccaaatgccgac
agcgaaacattaaaacaggtaagtgaaaaaggtgaaggttatacctacctgttatctcgc
gctggtgtgacgggtacggagtcaaaggccggtatgccaatcagtgatattctaaatcgt
ctaaaagagtttaatggtgcgccgccactactaggttttggtattgccgagccgagtcag
gtcaaagccgctatcgatgctggagccgcgggcgcgatttcaggctctgcggtagtcaaa
attatcgaggcgaataaagacaatgaagcggcactgttaagcgcccttgctgaatttact
cgcaatatgaaagcggcaaccgctcgttaa

DBGET integrated database retrieval system