KEGG   Shewanella pealeana: Spea_1586Help
Entry
Spea_1586         CDS       T00606                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
spl  Shewanella pealeana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spea_1586
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spea_1586
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spea_1586
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spea_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1924162..1925391)
Genome map
AA seq 409 aa AA seqDB search
MSKLNPYFGEYGGMYVPQILMPALKQLETAFIEAQEDESFQQEFTELLKNYAGRPTALTL
TRNLSPNPLTKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLGLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSATLKDACNEAMRDWSGSY
DKAHYLLGTAAGPHPFPTIVREFQRMIGEETKSQILEREGRLPDAVIACVGGGSNAIGMF
ADFIDEEEVALIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYSVS
AGLDFPSVGPQHAHLAATGRATYESATDDEALEAFQLLARSEGIIPALESAHALAYAVKL
AKEATKETILVVNLSGRGDKDIFTVADILEQQKVEQQEAEQQQTNNQNN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttaaacccatactttggggaatacggtggtatgtacgtaccgcaaatttta
atgccagcgcttaagcaactagaaaccgcttttattgaagcccaagaagacgagagcttt
cagcaggagtttaccgagcttttaaagaactatgccggtcgtccaacggcgttgacctta
acgcgcaacttaagccctaatccgctgactaagatctatctaaaacgtgaagatttgcta
cacggcggcgcccacaagactaaccaagtattaggtcaggcattactggctaaacgtatg
ggtaaaaaagagatcatcgctgaaactggcgcgggtcaacacggtgtggcaacagccctt
gcctgcgcattgctaggccttaagtgtaaggtgtatatgggcgcgaaagacgttgaacgt
caatcaccaaacgtatttagaatgaagctaatgggcgcagaagttatcccagtgacctct
ggctcggccactttgaaagatgcctgtaacgaagcgatgcgtgactggtctggtagttat
gataaagcccactacctactgggcactgcagcaggtccgcacccattcccaacaattgta
cgtgaattccaacgtatgattggcgaagaaactaagagtcaaattcttgagcgtgaaggc
cgcctacctgatgcggttattgcctgtgtcggcggtggttctaacgcgattggtatgttt
gccgactttattgacgaagaagaggtggcactaattggtgttgagcctgcaggaaaaggc
atcgatactccaatgcacggcgcgccactaaagcatggtaaaactggtattttctttggt
atgaaagcgccacttatgcaagacagcgaagggcaaattgaagagtcttactctgtatcc
gccggtctggatttcccatctgttgggccgcagcatgcacaccttgccgcaaccggccgc
gcaacttacgagtcagccaccgatgatgaagcgttagaagctttccaattactggcacga
tcagaagggatcatccccgcacttgagtcggctcacgccctagcttatgcggtaaaactt
gcaaaagaagccaccaaagagaccattttagtggttaacctgtctggccgcggcgacaaa
gatatcttcacggttgcggacattcttgagcaacaaaaagttgagcaacaagaagctgaa
cagcaacaaactaacaatcagaacaactag

DBGET integrated database retrieval system