KEGG   Shewanella pealeana: Spea_1660Help
Entry
Spea_1660         CDS       T00606                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
spl  Shewanella pealeana
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Spea_1660
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Spea_1660
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Spea_1660
Lipid biosynthesis proteins [BR:spl01004]
 Fatty acid synthase
  Component type
   Spea_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2011695..2012324)
Genome map
AA seq 209 aa AA seqDB search
MALFSDIGSFFDFKNRLGGLLLLLVFSSFGLNAAPILILGDSLSASYGMPEDQGWVQLLR
EKMPEHSIINGSVSGETSAGGLRRLPALLDSAQPKLLLVELGGNDGLRGFPPKQLKNNLT
KIIELAKAQQITILLSEIMVPPNYGPRYASQISTVYKELAEEHGVTLMPFFMEQIVTDST
LMQRDGIHPNQKAQPAIAEFMLPWFEQAL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcactattttcagacataggatccttcttcgacttcaaaaaccgactcggcggtttg
ctcttattattggttttcagcagttttgggctgaatgctgcccctatattaatcctaggt
gatagcctaagtgcaagttatggcatgcctgaagatcaaggttgggtacaactattacga
gaaaaaatgcccgaacacagcatcataaatggttcggtgagcggtgaaacatcggctggc
ggtttgcgtagactacccgcactgcttgattctgcgcagcctaagctgctattagtcgaa
ctcggcggcaacgatggtttgcgtggttttcccccgaagcaattgaaaaacaatcttaca
aaaattattgagcttgccaaagctcagcagatcacaattttgctgagcgaaattatggtg
ccacctaactatggcccaagatacgcatcgcaaattagtactgtttataaagaacttgca
gaagagcatggggttaccctgatgccatttttcatggagcaaatcgtcacggattcaact
ttaatgcaaagagatggcatccatcctaatcaaaaagcgcaaccagcaattgccgagttt
atgttgccatggtttgagcaggctttataa

DBGET integrated database retrieval system