KEGG   Shewanella pealeana: Spea_1785Help
Entry
Spea_1785         CDS       T00606                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
spl  Shewanella pealeana
Pathway
spl00020  Citrate cycle (TCA cycle)
spl00190  Oxidative phosphorylation
spl00650  Butanoate metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01200  Carbon metabolism
Module
spl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spea_1785
   00650 Butanoate metabolism
    Spea_1785
  Energy metabolism
   00190 Oxidative phosphorylation
    Spea_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABV87108
JGI: Spea1785
UniProt: A8H3H1
Position
2179579..2179932
Genome map
AA seq 117 aa AA seqDB search
MGMVTNAASLGRSGVHDFILIRASAVVLACYTIFLVGFIACSSPLTYDVWHGLFSTLPMK
VFTLLALVAVLVHAWIGIWQVLTDYVKCVALRGVLQFVFVIAAFSYLAAGILIVWGV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatggtaactaacgcagcaagtcttggccgcagtggtgtccatgactttattctt
atacgtgcaagtgctgtagtcctagcctgttataccatttttttggttgggtttatcgca
tgtagctctccactaacttatgacgtatggcatggcttatttagcaccttgccgatgaaa
gtctttacactactcgcgctagtagcggttttagttcatgcctggattggaatttggcag
gtgctaaccgattacgttaagtgcgttgcactacgtggtgtacttcagtttgtttttgtc
atcgccgcattcagctatttagctgcaggcattttgattgtgtggggtgtttaa

DBGET integrated database retrieval system