KEGG   Shewanella pealeana: Spea_1785Help
Entry
Spea_1785         CDS       T00606                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
spl  Shewanella pealeana
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spea_1785
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spea_1785
   00650 Butanoate metabolism
    Spea_1785
  Energy metabolism
   00190 Oxidative phosphorylation
    Spea_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2179579..2179932
Genome map
AA seq 117 aa AA seqDB search
MGMVTNAASLGRSGVHDFILIRASAVVLACYTIFLVGFIACSSPLTYDVWHGLFSTLPMK
VFTLLALVAVLVHAWIGIWQVLTDYVKCVALRGVLQFVFVIAAFSYLAAGILIVWGV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatggtaactaacgcagcaagtcttggccgcagtggtgtccatgactttattctt
atacgtgcaagtgctgtagtcctagcctgttataccatttttttggttgggtttatcgca
tgtagctctccactaacttatgacgtatggcatggcttatttagcaccttgccgatgaaa
gtctttacactactcgcgctagtagcggttttagttcatgcctggattggaatttggcag
gtgctaaccgattacgttaagtgcgttgcactacgtggtgtacttcagtttgtttttgtc
atcgccgcattcagctatttagctgcaggcattttgattgtgtggggtgtttaa

DBGET integrated database retrieval system