KEGG   Shewanella pealeana: Spea_1789Help
Entry
Spea_1789         CDS       T00606                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spl  Shewanella pealeana
Pathway
spl00020  Citrate cycle (TCA cycle)
spl00310  Lysine degradation
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01200  Carbon metabolism
Module
spl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spea_1789
  Amino acid metabolism
   00310 Lysine degradation
    Spea_1789
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Spea_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABV87112
JGI: Spea1789
UniProt: A8H3H5
Position
2185482..2186678
Genome map
AA seq 398 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVQAGEQVSRDQILVDIETDKVVLEVVAPEDGQVAEFL
AQEGDTVLGEAVIASFIAGAVAGQEVTKAQAEAATPASDASDESNDALSPSVRRLIAEHN
VDANAINGTGVGGRITKEDVEAFVKNKPAAAPASASAPAAVAPLAERSEKRVPMTRLRKT
IANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQEVFEKRHGIRLGFMSFYVKAVTEALK
RFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDKMSLADIERNVRELAIKGR
DGKLTVDDMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPM
MYLALSYDHRIVDGRESVGYLVAIKDFLEDPTRLLLDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgttctgccagaatcagttgcagatgcaaccattgct
acttggcatgttcaagctggcgagcaagtttctcgtgatcaaatccttgttgatattgaa
actgataaagtcgtacttgaagttgttgcaccagaagatggacaagttgctgagtttcta
gctcaggaaggtgacacagttcttggtgaagcagtgattgctagctttattgctggcgca
gttgcaggtcaagaagtcactaaagcccaagcggaagcggcaacgcctgcaagcgatgca
tctgacgagtcaaacgacgcactaagcccttcagttcgccgtcttatcgcagagcataat
gttgatgccaatgcgattaatggcacgggtgttggcggacgcatcactaaagaagacgtt
gaagcgttcgttaagaacaagcctgcagcagcgccagcaagtgcttcagcacctgctgca
gtggcgccattagccgagcgtagcgaaaagcgtgtgcctatgacacgtcttcgtaaaacg
attgctaatcgtctgcttgaagcaaaaaactctacggctatgctaacaacgtttaacgaa
gttaacatgaagccaattatggatatccgtaagcaatatcaagaggtttttgagaagcgc
cacggtattcgtctaggtttcatgtctttctatgttaaggctgttactgaagcgcttaag
cgtttccctgaagtgaatgcatcaatcgatggtgatgacattgtttatcacaactacttt
gatatcagcatcgcagtgtcgactcctcgtggcctagtgacaccagttttgcgtgacact
gacaagatgagccttgccgatatcgagcgtaatgttcgtgaactagccattaaaggtcgt
gacggtaagttaactgttgatgacatgactggcggtaacttcaccgtgactaacggtggt
gtatttggctcattgatgtcaacgccaattttgaatttgccacagagtgcgatcttaggc
atgcatgccatcaaagatcgccctatggcagtaaatggtcaggttgaaatcctgcctatg
atgtacctcgcactttcttacgatcaccgtattgtagatggacgtgaatcagttggttac
ttggttgctattaaagacttccttgaagatccaactcgtctgcttcttgacctataa

DBGET integrated database retrieval system