KEGG   Shewanella pealeana: Spea_2043Help
Entry
Spea_2043         CDS       T00606                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
spl  Shewanella pealeana
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spea_2043
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2043
   00630 Glyoxylate and dicarboxylate metabolism
    Spea_2043
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Spea_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2473349..2475523
Genome map
AA seq 724 aa AA seqDB search
MTARIRVGGLQIAKSLWELVDSEICPGTGISSQIFWTKFEDIVNELGPVNRQLLDKRDQL
QAQIDEWHKGNAQQSFDSIQYKQFLMDIGYLVEEGQPFTISTENVDLEITTQAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDAISFADGAEITKEYNPVRGAKVIAFAKNLLDTAA
PLASGLHSQVTRYFVEDNALKALLENGEQTVLVEPSKFVGFKGEAETPSALLLVNNALHI
EIQINPDSLIGQTDLAGVKDLLIEAAVTTIMDCEDSVAAVDAEDKVEVYRNWLGLMQGKL
TASLKKNGKEIVRELNDDRVYTGTHGQSVTLSGRSLLFVRNVGHLMTNDAVLDKNGDEVP
EGILDGMVTVLAAMHDLKGNNNQRSNSRKGSVNIVKPKMHGPEEVQFTCDLFTRIEDALK
LSRNTIKVGIMDEERRTTVNLKECIRAAQERVVFINTGFLDRTGDEIHTSMLAGPFVAKS
VMKLQAWIKAYEDWNVDIGLECGLQGRSQIGKGMWPMPDEMAAMLEQKMGHPKAGANTAW
VPSPNGAALHATHYHQINVTQVQDELKQRKRASLDDLLTIPLMQQGERLTAEQKQFELDN
NAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQYLANWLHHGVCTKDEVMA
SLKKMAQVVDKQNQADSEYTNMAPNFDGVAFKAACDLIFKGELQPSGYTEPLLHAYRKQA
KLQS
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaggatccgagtcggtggtttacaaattgctaaatcactttgggaattagtt
gatagcgagatctgtcctggaactgggatcagctcacagattttctggacgaaatttgaa
gatatagtcaacgagcttggcccagtcaatagacaactactagataaacgtgatcaatta
caagctcaaatcgatgaatggcacaaaggaaatgcacaacaatcttttgactcgattcaa
tataagcagtttctcatggatattggttatctagtcgaagaggggcagccttttactatc
tctaccgaaaatgtagatttagagatcaccactcaagccggacctcagttggttgtgcca
gtcaagaatgcacgctttgccttaaatgccgccaacgcccgttgggggagcctctacgat
gcactatatggtactgatgccatttcatttgcagatggcgcagagatcaccaaagaatat
aatcccgtgcgtggtgcaaaggtgatcgcttttgctaaaaaccttttagatactgcagcg
ccattagcatcagggctacatagtcaagtaactcgatacttcgtagaagataatgcctta
aaggctctgctagaaaacggtgagcagactgttttagtcgagccaagtaagtttgttggt
tttaaaggtgaggccgaaacaccatcggcgctattgctagtgaataacgctttacatatc
gagatccaaatcaatccagatagtttgattggtcaaactgatcttgctggggttaaagat
ttattaatcgaagccgcagttacgaccattatggattgtgaggattcagttgcagcggtt
gacgccgaagataaagtggaagtttatcgtaattggctagggctgatgcaaggcaagctg
acagcttcactgaaaaagaatggcaaagagattgtacgtgagctaaacgatgacagagta
tacacaggcactcatgggcagagtgtaacgctttctggacgtagtctgctgtttgtccgc
aatgtcggtcacctaatgacaaatgatgccgtgcttgataaaaatggcgacgaagtgcct
gaggggatcctcgatggcatggtcactgtactggcagcaatgcacgatcttaaaggcaat
aataaccagcgcagtaatagccgtaaaggctcggtcaatatcgttaagccgaaaatgcac
ggtccagaagaagttcaattcacctgtgatctgtttacacgcatagaagatgcgttaaag
ctttcacgaaataccatcaaagtggggatcatggatgaagagcgtcgcacaacagtcaat
cttaaggagtgtatccgagcggcgcaggaacgtgtggtcttcatcaatacaggtttctta
gatagaaccggtgatgaaattcatacttctatgctggctgggccatttgttgccaaatct
gtgatgaaactgcaggcgtggatcaaggcatacgaagattggaacgtggacatcggccta
gagtgtggcttacaaggtcgctcgcaaataggcaaaggtatgtggccaatgccggatgag
atggctgcgatgttagaacaaaaaatgggtcatccaaaagcgggagccaatacagcctgg
gttccatcgcctaatggtgcagctttacacgcgacccactatcatcagattaatgttaca
caggttcaagatgagcttaagcagcgcaagcgcgcaagcttggatgatctactgactatt
ccacttatgcaacagggagagcgactcactgccgagcaaaagcagtttgagctagataat
aatgcacaaggtatattaggttatgtagtccgctggattgaccaaggcgtgggctgctct
aaagtgccggatatcaataatgtgggtttgatggaagacagggcaaccttgcgtatttcg
tctcaatacctcgctaattggttgcaccatggcgtgtgcaccaaagatgaggtgatggca
tcacttaagaagatggcgcaagtggtcgataagcaaaaccaagccgacagcgaatatacc
aatatggcaccgaacttcgatggtgttgcgtttaaagcagcttgcgacttgatcttcaaa
ggggagctgcagccatcaggctatactgagcctttgctgcatgcttatcgaaagcaagca
aaactgcagtcgtaa

DBGET integrated database retrieval system