KEGG   Shewanella pealeana: Spea_2043Help
Entry
Spea_2043         CDS       T00606                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
spl  Shewanella pealeana
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spea_2043
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2043
   00630 Glyoxylate and dicarboxylate metabolism
    Spea_2043
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Spea_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2473349..2475523
Genome map
AA seq 724 aa AA seqDB search
MTARIRVGGLQIAKSLWELVDSEICPGTGISSQIFWTKFEDIVNELGPVNRQLLDKRDQL
QAQIDEWHKGNAQQSFDSIQYKQFLMDIGYLVEEGQPFTISTENVDLEITTQAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDAISFADGAEITKEYNPVRGAKVIAFAKNLLDTAA
PLASGLHSQVTRYFVEDNALKALLENGEQTVLVEPSKFVGFKGEAETPSALLLVNNALHI
EIQINPDSLIGQTDLAGVKDLLIEAAVTTIMDCEDSVAAVDAEDKVEVYRNWLGLMQGKL
TASLKKNGKEIVRELNDDRVYTGTHGQSVTLSGRSLLFVRNVGHLMTNDAVLDKNGDEVP
EGILDGMVTVLAAMHDLKGNNNQRSNSRKGSVNIVKPKMHGPEEVQFTCDLFTRIEDALK
LSRNTIKVGIMDEERRTTVNLKECIRAAQERVVFINTGFLDRTGDEIHTSMLAGPFVAKS
VMKLQAWIKAYEDWNVDIGLECGLQGRSQIGKGMWPMPDEMAAMLEQKMGHPKAGANTAW
VPSPNGAALHATHYHQINVTQVQDELKQRKRASLDDLLTIPLMQQGERLTAEQKQFELDN
NAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQYLANWLHHGVCTKDEVMA
SLKKMAQVVDKQNQADSEYTNMAPNFDGVAFKAACDLIFKGELQPSGYTEPLLHAYRKQA
KLQS
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaggatccgagtcggtggtttacaaattgctaaatcactttgggaattagtt
gatagcgagatctgtcctggaactgggatcagctcacagattttctggacgaaatttgaa
gatatagtcaacgagcttggcccagtcaatagacaactactagataaacgtgatcaatta
caagctcaaatcgatgaatggcacaaaggaaatgcacaacaatcttttgactcgattcaa
tataagcagtttctcatggatattggttatctagtcgaagaggggcagccttttactatc
tctaccgaaaatgtagatttagagatcaccactcaagccggacctcagttggttgtgcca
gtcaagaatgcacgctttgccttaaatgccgccaacgcccgttgggggagcctctacgat
gcactatatggtactgatgccatttcatttgcagatggcgcagagatcaccaaagaatat
aatcccgtgcgtggtgcaaaggtgatcgcttttgctaaaaaccttttagatactgcagcg
ccattagcatcagggctacatagtcaagtaactcgatacttcgtagaagataatgcctta
aaggctctgctagaaaacggtgagcagactgttttagtcgagccaagtaagtttgttggt
tttaaaggtgaggccgaaacaccatcggcgctattgctagtgaataacgctttacatatc
gagatccaaatcaatccagatagtttgattggtcaaactgatcttgctggggttaaagat
ttattaatcgaagccgcagttacgaccattatggattgtgaggattcagttgcagcggtt
gacgccgaagataaagtggaagtttatcgtaattggctagggctgatgcaaggcaagctg
acagcttcactgaaaaagaatggcaaagagattgtacgtgagctaaacgatgacagagta
tacacaggcactcatgggcagagtgtaacgctttctggacgtagtctgctgtttgtccgc
aatgtcggtcacctaatgacaaatgatgccgtgcttgataaaaatggcgacgaagtgcct
gaggggatcctcgatggcatggtcactgtactggcagcaatgcacgatcttaaaggcaat
aataaccagcgcagtaatagccgtaaaggctcggtcaatatcgttaagccgaaaatgcac
ggtccagaagaagttcaattcacctgtgatctgtttacacgcatagaagatgcgttaaag
ctttcacgaaataccatcaaagtggggatcatggatgaagagcgtcgcacaacagtcaat
cttaaggagtgtatccgagcggcgcaggaacgtgtggtcttcatcaatacaggtttctta
gatagaaccggtgatgaaattcatacttctatgctggctgggccatttgttgccaaatct
gtgatgaaactgcaggcgtggatcaaggcatacgaagattggaacgtggacatcggccta
gagtgtggcttacaaggtcgctcgcaaataggcaaaggtatgtggccaatgccggatgag
atggctgcgatgttagaacaaaaaatgggtcatccaaaagcgggagccaatacagcctgg
gttccatcgcctaatggtgcagctttacacgcgacccactatcatcagattaatgttaca
caggttcaagatgagcttaagcagcgcaagcgcgcaagcttggatgatctactgactatt
ccacttatgcaacagggagagcgactcactgccgagcaaaagcagtttgagctagataat
aatgcacaaggtatattaggttatgtagtccgctggattgaccaaggcgtgggctgctct
aaagtgccggatatcaataatgtgggtttgatggaagacagggcaaccttgcgtatttcg
tctcaatacctcgctaattggttgcaccatggcgtgtgcaccaaagatgaggtgatggca
tcacttaagaagatggcgcaagtggtcgataagcaaaaccaagccgacagcgaatatacc
aatatggcaccgaacttcgatggtgttgcgtttaaagcagcttgcgacttgatcttcaaa
ggggagctgcagccatcaggctatactgagcctttgctgcatgcttatcgaaagcaagca
aaactgcagtcgtaa

DBGET integrated database retrieval system