KEGG   Shewanella pealeana: Spea_2117Help
Entry
Spea_2117         CDS       T00606                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
spl  Shewanella pealeana
Pathway
spl00362  Benzoate degradation
spl00620  Pyruvate metabolism
spl00621  Dioxin degradation
spl00622  Xylene degradation
spl00650  Butanoate metabolism
spl01100  Metabolic pathways
spl01120  Microbial metabolism in diverse environments
spl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2117
   00650 Butanoate metabolism
    Spea_2117
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spea_2117
   00622 Xylene degradation
    Spea_2117
   00621 Dioxin degradation
    Spea_2117
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Spea_2117
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Spea_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABV87437
JGI: Spea2117
UniProt: A8H4F0
Position
complement(2561614..2562537)
Genome map
AA seq 307 aa AA seqDB search
MTSKIKCALIGSGNIGTDLLYKLLRSDVLEPVWMVGIDPDSDGLAKAKAAGLKVTADGID
GLLPFVEADEIKIAFDATSAYVHAENSRKLNELGVVMIDLTPAAIGPFCVPPVNLEQLDE
NINNINMVTCGGQATIPMVAAVSQVQAVEYGEIVATVSSRSVGPGTRQNIDEFTRTTAGA
VEQIGGAEKGKAIIVINPAEPPLLMRDTIHCLTKDQPDEQAITASVHKMIEQVQQYVPGY
TLKNGPVFDGRKVTIFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMLASKMLNVKTHLNV
TKEAALA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaataaaatgtgcgctgattggctctggcaatattggcaccgacctactg
tacaaattactgcgaagtgatgtgcttgagccggtgtggatggtaggaatagacccagac
tctgacggtttagctaaagctaaagctgctgggctaaaagtaaccgctgatggtatagat
ggtttacttccctttgttgaagccgatgagataaaaattgctttcgatgcgacatcagct
tatgtgcatgcagaaaattcaagaaaactaaatgaattaggggtggtgatgattgattta
accccagctgcaattggtcccttttgcgtaccgccagtcaaccttgagcaacttgatgaa
aatattaacaacattaatatggtcacctgtggtggacaagcaactattcctatggttgca
gcggtgtcacaagtacaggctgtagagtacggtgaaattgttgccacggtatcttcgcgc
tccgtgggtccgggaacgaggcaaaacattgatgaatttacccgtaccacagctggtgca
gttgaacaaattggcggtgcagaaaaaggcaaagctattattgtcattaaccctgctgag
ccaccgttactgatgcgcgataccattcattgtctaacaaaagatcaacccgatgaacag
gcgattactgcatctgttcataagatgattgaacaagttcaacaatatgtacccggttac
acccttaaaaacggtccggtgtttgatggtcgtaaggtcactatctttttagaagtcgaa
gggctgggcgattacttaccaaagtatgccggtaacctagacataatgaccgctgcagca
gccagaacagcagaaatgctagcgtccaaaatgctcaatgttaaaacccatcttaacgtt
accaaagaagcggcgctagcctag

DBGET integrated database retrieval system