KEGG   Shewanella pealeana: Spea_2117Help
Entry
Spea_2117         CDS       T00606                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
spl  Shewanella pealeana
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spl00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:spl00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:spl00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:spl00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:spl00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2561614..2562537)
Genome map
AA seq 307 aa AA seqDB search
MTSKIKCALIGSGNIGTDLLYKLLRSDVLEPVWMVGIDPDSDGLAKAKAAGLKVTADGID
GLLPFVEADEIKIAFDATSAYVHAENSRKLNELGVVMIDLTPAAIGPFCVPPVNLEQLDE
NINNINMVTCGGQATIPMVAAVSQVQAVEYGEIVATVSSRSVGPGTRQNIDEFTRTTAGA
VEQIGGAEKGKAIIVINPAEPPLLMRDTIHCLTKDQPDEQAITASVHKMIEQVQQYVPGY
TLKNGPVFDGRKVTIFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMLASKMLNVKTHLNV
TKEAALA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaataaaatgtgcgctgattggctctggcaatattggcaccgacctactg
tacaaattactgcgaagtgatgtgcttgagccggtgtggatggtaggaatagacccagac
tctgacggtttagctaaagctaaagctgctgggctaaaagtaaccgctgatggtatagat
ggtttacttccctttgttgaagccgatgagataaaaattgctttcgatgcgacatcagct
tatgtgcatgcagaaaattcaagaaaactaaatgaattaggggtggtgatgattgattta
accccagctgcaattggtcccttttgcgtaccgccagtcaaccttgagcaacttgatgaa
aatattaacaacattaatatggtcacctgtggtggacaagcaactattcctatggttgca
gcggtgtcacaagtacaggctgtagagtacggtgaaattgttgccacggtatcttcgcgc
tccgtgggtccgggaacgaggcaaaacattgatgaatttacccgtaccacagctggtgca
gttgaacaaattggcggtgcagaaaaaggcaaagctattattgtcattaaccctgctgag
ccaccgttactgatgcgcgataccattcattgtctaacaaaagatcaacccgatgaacag
gcgattactgcatctgttcataagatgattgaacaagttcaacaatatgtacccggttac
acccttaaaaacggtccggtgtttgatggtcgtaaggtcactatctttttagaagtcgaa
gggctgggcgattacttaccaaagtatgccggtaacctagacataatgaccgctgcagca
gccagaacagcagaaatgctagcgtccaaaatgctcaatgttaaaacccatcttaacgtt
accaaagaagcggcgctagcctag

DBGET integrated database retrieval system