KEGG   Shewanella pealeana: Spea_2278Help
Entry
Spea_2278         CDS       T00606                                 

Definition
hypothetical protein
Organism
spl  Shewanella pealeana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2758794..2759069)
Genome map
AA seq 91 aa AA seqDB search
MFYEKLSSGKPLGRFSANHIAIKHAESATPVLGRVERFFASIESLGINTLVVIGHGEWLR
VLQNVASGVALGRNSKKFPQTVSILSLLCNG
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgttttatgaaaaattatccagtggtaagccccttggccgtttcagtgcaaatcatatc
gccatcaaacatgccgagtctgcaacgccggtattaggaagagtagagcgcttctttgcc
agtattgagtcactcggcatcaataccttagtggtcattggtcatggagagtggctacgg
gttttacaaaatgttgccagtggggtggcccttggtcggaacagcaaaaaattcccgcaa
actgtgagtattttgagtttgctctgtaatggctaa

DBGET integrated database retrieval system