KEGG   Shewanella pealeana: Spea_2290Help
Entry
Spea_2290         CDS       T00606                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
spl  Shewanella pealeana
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Spea_2290
   00565 Ether lipid metabolism
    Spea_2290
   00590 Arachidonic acid metabolism
    Spea_2290
   00591 Linoleic acid metabolism
    Spea_2290
   00592 alpha-Linolenic acid metabolism
    Spea_2290
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Spea_2290
    3.1.1.32  phospholipase A1
     Spea_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2774152..2775009)
Genome map
AA seq 285 aa AA seqDB search
MKHKTNIKTYVILLASLLAAGSLQAKEQATISNDITGVAGLTPADDLYKLTVFDNNFILP
IYQTQSANQAYYAPQNPNNENISNTNLQFQFSLKYGIANNLFTDNDGFYIAYSQISNWQA
YDKSAYFRDSQYQPQVFWFWQHGKADDTWRSTSLGFEHQSNGKGGIYERSWNRVYLEFSL
AYKDIEISIKPWLRADFSSTDYNPDIEDYMGYGTVKGDWYFGDHQVSLTLRNLVESGFSK
GYEELSWRFPIYKGLRGYLKLQSGYGMTISDYNHFDNAVGIGIAL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcataaaaccaatattaaaacctatgtcattttactagcaagcttactggctgca
ggttcactccaggcaaaagagcaagccactattagtaatgatatcacaggggttgcaggg
ttaactccagctgatgatctttataagttaacggtgtttgacaacaacttcattttaccg
atttaccaaacgcaatcagcaaatcaagcttactacgctccccaaaacccaaataatgag
aacattagtaacaccaatctgcagtttcaatttagtcttaaatatggcatcgcgaacaat
ctcttcactgacaatgatggcttttacatcgcttacagccaaatatctaattggcaggct
tacgacaagtcggcctactttcgagattcacaatatcagccgcaagtgttttggttctgg
caacacgggaaggccgatgatacttggcgaagtactagcctaggtttcgagcaccaatca
aatggcaaaggtggcatttatgagcgaagttggaaccgcgtttatttggagttttcattg
gcatataaggatattgaaatcagtataaagccttggctaagagctgacttttcaagtacg
gattataaccctgatattgaagactatatgggctatggcacagtcaaaggtgattggtat
tttggtgatcatcaagtgagcttaaccctaagaaaccttgtagaaagtggtttttctaaa
ggctatgaagagttgagttggcgctttccaatatataaaggcttaagaggctatctaaag
ctgcaaagtggctacgggatgaccatttctgattataatcattttgataatgcagtaggc
attggtattgcgctttaa

DBGET integrated database retrieval system