KEGG   Shewanella pealeana: Spea_2360Help
Entry
Spea_2360         CDS       T00606                                 

Definition
lactoylglutathione lyase (EC:4.4.1.5)
Orthology
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
spl  Shewanella pealeana
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2360
Enzymes [BR:spl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     Spea_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2876595..2877005
Genome map
AA seq 136 aa AA seqDB search
MAQLLHTMLRVGNLERSIEFYTKVLGMKLLRQSENSEYKYTLAFVGYDEESTGSAVIELT
YNWGTESYDHGNAFGHIAIGEEDIYARCEAIAAAGGKVIRPAGPVAGGTTEIAFVEDPDG
YKIEFIQMSSAENGLG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactactacacaccatgctccgcgttggcaatcttgaacgcagtatcgagttt
tacaccaaggttttaggcatgaagctgctaagacagagtgagaacagcgaatataaatac
accttggcttttgtcggctatgacgaagagtcaacgggtagcgcggttatagaactgacc
tataactggggaactgagtcttatgatcatggcaatgcatttggtcatatcgctatcggt
gaagaagatatctatgcgcgctgtgaagctatcgctgcggcaggtggcaaggttatacgc
ccggcgggacctgttgctggcggcacgactgaaattgcttttgtagaagatcctgatggc
tacaaaattgaatttattcagatgagttcggctgaaaacggtttaggttaa

DBGET integrated database retrieval system