KEGG   Shewanella pealeana: Spea_2360Help
Entry
Spea_2360         CDS       T00606                                 

Definition
(GenBank) lactoylglutathione lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
spl  Shewanella pealeana
Pathway
spl00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2360
Enzymes [BR:spl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     Spea_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 CppA_N Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: ABV87680
JGI: Spea2360
UniProt: A8H543
Position
2876595..2877005
Genome map
AA seq 136 aa AA seqDB search
MAQLLHTMLRVGNLERSIEFYTKVLGMKLLRQSENSEYKYTLAFVGYDEESTGSAVIELT
YNWGTESYDHGNAFGHIAIGEEDIYARCEAIAAAGGKVIRPAGPVAGGTTEIAFVEDPDG
YKIEFIQMSSAENGLG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactactacacaccatgctccgcgttggcaatcttgaacgcagtatcgagttt
tacaccaaggttttaggcatgaagctgctaagacagagtgagaacagcgaatataaatac
accttggcttttgtcggctatgacgaagagtcaacgggtagcgcggttatagaactgacc
tataactggggaactgagtcttatgatcatggcaatgcatttggtcatatcgctatcggt
gaagaagatatctatgcgcgctgtgaagctatcgctgcggcaggtggcaaggttatacgc
ccggcgggacctgttgctggcggcacgactgaaattgcttttgtagaagatcctgatggc
tacaaaattgaatttattcagatgagttcggctgaaaacggtttaggttaa

DBGET integrated database retrieval system