KEGG   Shewanella pealeana: Spea_2421Help
Entry
Spea_2421         CDS       T00606                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spl  Shewanella pealeana
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spea_2421
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Spea_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2958596..2960590
Genome map
AA seq 664 aa AA seqDB search
MITTTKPINDLLKEWQEQRLLTSLDRHFALQLAQLHQETAPLFTLICSLVSQYLSSQHTC
LPLKQIDTSNPFKEQISQCQININIDELEQTLLQFDAIGTADDAELKPLIIDKGNLYLQR
YFSYETQVAEHLNRLSFAPVDSSLNDDTELASASELLNQLFPANEQQYDWQKIATATAMT
KKLAVITGGPGTGKTTTVTKLLYLLCSRQEMTIRLVAPTGKAAARLSESIKASKLRLASE
MSQIGTADLEKNIAKIPEEAATLHRLLGVIPNSHQFRHHKDNPLRLDLLVIDEASMVDLP
MMHKVLSALPEHAKLILLGDQDQLASVEAGAVLADICAGLKQVNKKTKQSRWQMHYSPAQ
VELLSQLTSTSLAEFASANPKIGDSLCMLMHSHRFQGDAGIGQLATAVNHSNLPRIAEVW
QTGYQELCWIEHAIANTAHGSSSQVNSSSANKGLEALLVQTIEQYGVYLAAISQGDVDAD
KIIDSFNQYRILCAMRAGEYGVEGINQSVTTALAAKGLIHPEQEFYAGRPIIIQSNDYNL
GLFNGDIGLILPDSSSQTGRLMAHFIQADGSLLKVLPARLPSHETCYAMTVHKSQGSEFN
HVSLVLPIKPSIAQQQLLTKELVYTAITRAKHHFTCLGSQRVFEQASRCLTQRASGLAQR
LWRD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaccactaagccgattaacgatttactcaaagagtggcaagagcagcggctt
ctcacctcgctcgaccggcactttgccctgcaattagcccagcttcatcaagaaactgcg
ccgttattcacgcttatttgttccttagtgagtcagtatctctcaagccagcatacctgt
ctgccgctaaaacagattgataccagcaatccatttaaagagcagatcagccaatgccaa
atcaatatcaacattgatgagcttgaacaaacgttgttgcagtttgacgccattggcact
gccgatgacgccgagcttaaacctttgataatcgataaaggtaacctgtatcttcagcgt
tattttagctacgagacgcaggttgccgaacatctgaatcgactctcttttgcgccagtt
gactctagtcttaatgatgacactgaactggcgagcgccagtgaactattaaatcagtta
tttccagccaatgagcagcaatatgactggcaaaagatcgccaccgccactgctatgaca
aaaaagctagccgttattacaggcggccctggtacgggtaaaaccacaaccgttactaag
ctgctgtatttattatgctcaaggcaggagatgacgattaggctagtcgccccaacgggt
aaggctgcggcgcgccttagtgagtcgattaaagcgtcaaagcttagacttgccagtgag
atgagccaaattggcactgcagatctcgaaaaaaacatcgctaaaatcccagaagaagcg
gccaccctacaccgcttacttggggtgatcccaaattcacaccaatttaggcatcataaa
gacaacccactcaggctggatctgttagtgatagatgaagcctccatggttgatttacct
atgatgcacaaggtgctatcggctctgcctgagcatgctaaattaattctacttggcgac
caagatcagctcgcctcagttgaagcgggcgcggtgcttgccgatatctgtgctggttta
aaacaagttaataagaaaacaaagcagagtcgctggcagatgcattactcaccagcgcaa
gttgagctactgagccagttaaccagcacctccttagcggagtttgccagcgcaaatcca
aaaatcggtgatagcttatgcatgctgatgcacagccaccgctttcagggggatgccggt
attggtcaattggcaacggcggtcaatcactctaacttacctcgtatcgccgaggtttgg
cagacaggctatcaagaattatgctggatagaacatgctatcgctaatactgcccacggc
agcagttcgcaagtaaatagctcatcagctaataaagggcttgaagcgctacttgttcag
accattgagcaatatggcgtgtacctagcggccatctcacaaggggacgtcgatgcagac
aagatcatcgacagctttaatcaataccgtattttatgtgccatgcgcgccggagaatat
ggcgtcgagggaataaaccagagtgtcactacagcactagccgctaagggactcatccat
ccggagcaagagttttatgctggccgccctatcatcattcagagcaatgattacaaccta
ggcttatttaacggtgatatcggcttgattttacccgatagcagtagccaaacaggtcgt
ttaatggcgcactttattcaggccgacggcagcttacttaaggtgctaccagcgcgatta
ccgagccatgagacctgttatgccatgactgtacataagagccaaggtagtgagtttaac
catgtatccttggtgctaccgataaaaccaagtatcgcacagcaacagctcttaactaaa
gagttagtctataccgccatcactcgcgcaaagcatcactttacctgccttggcagccag
agagtgtttgagcaagccagtcgctgtctaacccagcgagcctcgggcttggcgcaacgt
ttatggcgcgattaa

DBGET integrated database retrieval system