KEGG   Shewanella pealeana: Spea_2421Help
Entry
Spea_2421         CDS       T00606                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spl  Shewanella pealeana
Pathway
spl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spea_2421
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Spea_2421
DNA repair and recombination proteins [BR:spl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Spea_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 Helicase_RecD AAA_11 AAA_22 DUF2075 UvrD_C UvrD-helicase PIF1 PhoH AAA_28 AAA_29 AAA_16 Flavi_DEAD T2SSE NTPase_1 TrwB_AAD_bind ResIII SRP54 AAA_5 ABC_tran ArgK ATPase CbiA AAA_24 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ABV87741
JGI: Spea2421
UniProt: A8H5A4
Position
2958596..2960590
Genome map
AA seq 664 aa AA seqDB search
MITTTKPINDLLKEWQEQRLLTSLDRHFALQLAQLHQETAPLFTLICSLVSQYLSSQHTC
LPLKQIDTSNPFKEQISQCQININIDELEQTLLQFDAIGTADDAELKPLIIDKGNLYLQR
YFSYETQVAEHLNRLSFAPVDSSLNDDTELASASELLNQLFPANEQQYDWQKIATATAMT
KKLAVITGGPGTGKTTTVTKLLYLLCSRQEMTIRLVAPTGKAAARLSESIKASKLRLASE
MSQIGTADLEKNIAKIPEEAATLHRLLGVIPNSHQFRHHKDNPLRLDLLVIDEASMVDLP
MMHKVLSALPEHAKLILLGDQDQLASVEAGAVLADICAGLKQVNKKTKQSRWQMHYSPAQ
VELLSQLTSTSLAEFASANPKIGDSLCMLMHSHRFQGDAGIGQLATAVNHSNLPRIAEVW
QTGYQELCWIEHAIANTAHGSSSQVNSSSANKGLEALLVQTIEQYGVYLAAISQGDVDAD
KIIDSFNQYRILCAMRAGEYGVEGINQSVTTALAAKGLIHPEQEFYAGRPIIIQSNDYNL
GLFNGDIGLILPDSSSQTGRLMAHFIQADGSLLKVLPARLPSHETCYAMTVHKSQGSEFN
HVSLVLPIKPSIAQQQLLTKELVYTAITRAKHHFTCLGSQRVFEQASRCLTQRASGLAQR
LWRD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaccactaagccgattaacgatttactcaaagagtggcaagagcagcggctt
ctcacctcgctcgaccggcactttgccctgcaattagcccagcttcatcaagaaactgcg
ccgttattcacgcttatttgttccttagtgagtcagtatctctcaagccagcatacctgt
ctgccgctaaaacagattgataccagcaatccatttaaagagcagatcagccaatgccaa
atcaatatcaacattgatgagcttgaacaaacgttgttgcagtttgacgccattggcact
gccgatgacgccgagcttaaacctttgataatcgataaaggtaacctgtatcttcagcgt
tattttagctacgagacgcaggttgccgaacatctgaatcgactctcttttgcgccagtt
gactctagtcttaatgatgacactgaactggcgagcgccagtgaactattaaatcagtta
tttccagccaatgagcagcaatatgactggcaaaagatcgccaccgccactgctatgaca
aaaaagctagccgttattacaggcggccctggtacgggtaaaaccacaaccgttactaag
ctgctgtatttattatgctcaaggcaggagatgacgattaggctagtcgccccaacgggt
aaggctgcggcgcgccttagtgagtcgattaaagcgtcaaagcttagacttgccagtgag
atgagccaaattggcactgcagatctcgaaaaaaacatcgctaaaatcccagaagaagcg
gccaccctacaccgcttacttggggtgatcccaaattcacaccaatttaggcatcataaa
gacaacccactcaggctggatctgttagtgatagatgaagcctccatggttgatttacct
atgatgcacaaggtgctatcggctctgcctgagcatgctaaattaattctacttggcgac
caagatcagctcgcctcagttgaagcgggcgcggtgcttgccgatatctgtgctggttta
aaacaagttaataagaaaacaaagcagagtcgctggcagatgcattactcaccagcgcaa
gttgagctactgagccagttaaccagcacctccttagcggagtttgccagcgcaaatcca
aaaatcggtgatagcttatgcatgctgatgcacagccaccgctttcagggggatgccggt
attggtcaattggcaacggcggtcaatcactctaacttacctcgtatcgccgaggtttgg
cagacaggctatcaagaattatgctggatagaacatgctatcgctaatactgcccacggc
agcagttcgcaagtaaatagctcatcagctaataaagggcttgaagcgctacttgttcag
accattgagcaatatggcgtgtacctagcggccatctcacaaggggacgtcgatgcagac
aagatcatcgacagctttaatcaataccgtattttatgtgccatgcgcgccggagaatat
ggcgtcgagggaataaaccagagtgtcactacagcactagccgctaagggactcatccat
ccggagcaagagttttatgctggccgccctatcatcattcagagcaatgattacaaccta
ggcttatttaacggtgatatcggcttgattttacccgatagcagtagccaaacaggtcgt
ttaatggcgcactttattcaggccgacggcagcttacttaaggtgctaccagcgcgatta
ccgagccatgagacctgttatgccatgactgtacataagagccaaggtagtgagtttaac
catgtatccttggtgctaccgataaaaccaagtatcgcacagcaacagctcttaactaaa
gagttagtctataccgccatcactcgcgcaaagcatcactttacctgccttggcagccag
agagtgtttgagcaagccagtcgctgtctaacccagcgagcctcgggcttggcgcaacgt
ttatggcgcgattaa

DBGET integrated database retrieval system