KEGG   Shewanella pealeana: Spea_2478Help
Entry
Spea_2478         CDS       T00606                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
spl  Shewanella pealeana
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3022869..3023798)
Genome map
AA seq 309 aa AA seqDB search
MTTIADKPDYSLYSNAFGYLRQPLDFKPLEGDADVVVLGLPFDMATTGRSGGRMGPGAIR
NASVNLAWEETRWPYQFKLSEHVKIVDAGDLVYNCGDSADFTQRVEDFATKILEADKAML
SFGGDHFVTLPLLRAHYKKHGKMALLHFDAHTDTYSQGSKYDHGTMFYHAPNEGIIAAEN
SIQVGIRTEYDTSNHLFKVIDAAAANEMTADEIVAQIRERVGDMPLYVTFDIDCLDPAFA
PGTGTPVCGGLTSDKAMKIIRGLKGMKIVGMDVVEVAPAYDSAEITALAGATLGLEMLHV
WAESNGKIK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccactattgcagataagcctgattattcgctttattcaaatgcatttggttactta
agacagccgctagacttcaaaccattagaaggcgatgcggatgttgtagtgttaggctta
ccttttgatatggctactacgggtcgctctggtggacgtatgggcccaggtgcaattcgt
aatgcttcagtaaacctggcttgggaagaaactcgctggccttatcagtttaaactaagc
gagcatgttaaaatcgtcgatgcaggcgatctcgtttataactgtggtgattctgcagac
ttcacacagcgtgttgaagatttcgcaactaagatcttagaagctgataaggctatgcta
agttttggtggcgatcactttgtgactttgcccctgctacgtgctcactataagaagcac
ggtaagatggcgctattgcactttgatgcacataccgacacttatagccaaggtagtaag
tatgatcacggcaccatgttttatcatgcgccaaacgaagggatcattgctgcagagaac
tcaattcaagtcggtatccgtactgaatacgatacttccaatcatcttttcaaagttatc
gatgcggcggcagctaatgaaatgactgctgatgagatcgttgcacaaattcgtgaacgt
gttggcgatatgccgctatacgtgactttcgatattgactgtttagacccagctttcgct
cctggcacaggtacgccagtatgtggcggtttgaccagtgacaaggcgatgaaaatcatt
cgtggtttaaaaggcatgaagattgtgggtatggacgtggttgaagtggcaccagcctac
gacagcgcagagatcactgctttagcgggtgctactttgggcctagagatgttgcacgtt
tgggctgagtctaacggcaagatcaaataa

DBGET integrated database retrieval system