KEGG   Shewanella pealeana: Spea_2514Help
Entry
Spea_2514         CDS       T00606                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
spl  Shewanella pealeana
Brite
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Spea_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3063013..3064038
Genome map
AA seq 341 aa AA seqDB search
MANPLLRESATKLKKAIPLMLKHQIPTTPTNYALWYAYVGEKSPNLNQRLDEIVSQYSTC
PPSHSERLYQEYLADPAALNVVDMRLNLDAMVTELSQSLKDTNLDASQFHNKISSNYNKL
NKIENDGFTIEEVLTVVKSLVQDSNDIRMSAQHFSAQLAKAQSEIDALKQQLKQSEHEMH
YDALTSSLNRRAFDNDLKGILQQHPQGLCLIIADIDHFKVFNDTYGHQLGDQVLKAVTKR
LTEACKDGTKLYRFGGEEFALIVPKSELRRARQLAESMRRSLEKLTLKDKRKGETINNIS
ASFGVAEYQTDDTNIALIDRADSQLYQAKNLGRNRVMPIIR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccactgctaagggaatcggcaacaaagttaaaaaaagccattcctttgatg
ctaaaacatcagatcccgacaacgccaaccaactatgcgctttggtatgcttacgtcggt
gaaaaaagcccaaatcttaaccagcgcttagacgaaattgtcagccaatatagcacctgt
ccaccaagccatagcgagcggctatatcaagagtatctagccgatccagctgcgctaaat
gtggtcgatatgcgacttaatctcgatgctatggtgacagagctttcgcaatcattgaaa
gataccaaccttgatgccagccagttccataacaagataagtagcaactacaacaagctt
aacaaaattgagaatgacggctttaccattgaagaagtgctaactgttgtcaaaagtcta
gttcaggactccaatgacattcgcatgagcgcacagcatttctctgctcagctggctaaa
gcgcaatcagaaattgatgccctaaagcaacagttaaagcagtcagagcatgagatgcat
tatgatgcactaaccagctcgcttaatcgccgtgcattcgataatgatctaaaaggcatt
ttgcaacagcatccacaaggtctctgtctgataattgccgatatcgatcactttaaagtc
tttaacgatacctacggccaccagctcggcgaccaagtacttaaagccgtgactaaacgc
cttacggaagcctgtaaagacggcactaaactatatcgctttggcggcgaagaatttgct
cttatcgtgcctaagagcgaattacgacgcgctcgccaactggcagagtcaatgcgccgt
agcttggaaaagctcaccttaaaagataaacgtaaaggcgagacgattaacaacatcagc
gcttcttttggggtcgccgaatatcaaacagatgataccaatatcgcattaattgatcgc
gccgacagccagctgtatcaggctaagaaccttggccgcaaccgagtcatgccgataata
cgttag

DBGET integrated database retrieval system