KEGG   Shewanella pealeana: Spea_2514Help
Entry
Spea_2514         CDS       T00606                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
spl  Shewanella pealeana
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3063013..3064038
Genome map
AA seq 341 aa AA seqDB search
MANPLLRESATKLKKAIPLMLKHQIPTTPTNYALWYAYVGEKSPNLNQRLDEIVSQYSTC
PPSHSERLYQEYLADPAALNVVDMRLNLDAMVTELSQSLKDTNLDASQFHNKISSNYNKL
NKIENDGFTIEEVLTVVKSLVQDSNDIRMSAQHFSAQLAKAQSEIDALKQQLKQSEHEMH
YDALTSSLNRRAFDNDLKGILQQHPQGLCLIIADIDHFKVFNDTYGHQLGDQVLKAVTKR
LTEACKDGTKLYRFGGEEFALIVPKSELRRARQLAESMRRSLEKLTLKDKRKGETINNIS
ASFGVAEYQTDDTNIALIDRADSQLYQAKNLGRNRVMPIIR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccactgctaagggaatcggcaacaaagttaaaaaaagccattcctttgatg
ctaaaacatcagatcccgacaacgccaaccaactatgcgctttggtatgcttacgtcggt
gaaaaaagcccaaatcttaaccagcgcttagacgaaattgtcagccaatatagcacctgt
ccaccaagccatagcgagcggctatatcaagagtatctagccgatccagctgcgctaaat
gtggtcgatatgcgacttaatctcgatgctatggtgacagagctttcgcaatcattgaaa
gataccaaccttgatgccagccagttccataacaagataagtagcaactacaacaagctt
aacaaaattgagaatgacggctttaccattgaagaagtgctaactgttgtcaaaagtcta
gttcaggactccaatgacattcgcatgagcgcacagcatttctctgctcagctggctaaa
gcgcaatcagaaattgatgccctaaagcaacagttaaagcagtcagagcatgagatgcat
tatgatgcactaaccagctcgcttaatcgccgtgcattcgataatgatctaaaaggcatt
ttgcaacagcatccacaaggtctctgtctgataattgccgatatcgatcactttaaagtc
tttaacgatacctacggccaccagctcggcgaccaagtacttaaagccgtgactaaacgc
cttacggaagcctgtaaagacggcactaaactatatcgctttggcggcgaagaatttgct
cttatcgtgcctaagagcgaattacgacgcgctcgccaactggcagagtcaatgcgccgt
agcttggaaaagctcaccttaaaagataaacgtaaaggcgagacgattaacaacatcagc
gcttcttttggggtcgccgaatatcaaacagatgataccaatatcgcattaattgatcgc
gccgacagccagctgtatcaggctaagaaccttggccgcaaccgagtcatgccgataata
cgttag

DBGET integrated database retrieval system