KEGG   Shewanella pealeana: Spea_2558Help
Entry
Spea_2558         CDS       T00606                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
spl  Shewanella pealeana
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:spl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:spl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:spl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3113995..3115947
Genome map
AA seq 650 aa AA seqDB search
MSTQSLYKVPSEIAANALVNDEQYKKMYQESIVNPEGFWREHGNRIDWIKPFTKVKKTSF
DDHNLFIKWFYDGTLNASANCLDRHLENNADKLAIIWEGDDAKDQRTLTYGQLHAEVCKF
ANALRSQGVRRGDVVTVYMPMVPEAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNS
KVVITADEGVRAGRIIPLKANIDEALSHPDVNCVEKVIVMKRTGGDINWVEGRDIWWGSL
METASEHCIPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKENEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPTPARLGEMVDRHKVNILYTAPTL
IRALMAEGKEQFEGFDGSSLRIMGSVGEPINPEAWRWYNDVIGHEKCPIVDTWWQTETGG
ILISPLPGATDTKPGSATRPFFGVQPALVDNIGNIVEGANEGNLVILDSWPGQMRTVFGD
HDRFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHE
LVAEAAVVGYPHDIKGQGIYAYVTLTKGSVETEELRQELRQWVRKEIGALATPDLIQWAG
GLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIETRLNRSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtctctctataaagtaccaagtgaaatcgctgcaaacgcacttgtaaac
gatgaacaatataaaaaaatgtatcaggagtcgattgtaaaccctgaaggtttctggaga
gaacacggtaaccgtatcgactggatcaaaccttttactaaggtaaagaaaacctcattc
gatgaccacaatctatttatcaagtggttctatgacggcacgctcaatgcctctgctaac
tgtttagacaggcaccttgaaaacaatgccgataaattagcaattatctgggaaggtgat
gacgctaaagatcagcgcactctaacttacggccagcttcacgccgaagtttgtaaattc
gctaatgcacttcgtagccagggtgtacgtcgaggcgatgttgtgactgtttacatgcct
atggtgccagaggccgcagtcgccatgcttgcatgtgcccgaattggtgcaattcattcg
gttgtatttggtggcttctcaccggactctattgcttctcgcgttatcgatggcaactca
aaagtcgtcatcactgccgatgaaggcgttcgtgccggccgtatcattcctctaaaagcc
aatattgatgaagccctttctcaccctgatgtcaattgcgtcgaaaaagtgatcgtgatg
aaacgcacaggcggtgatattaactgggtagaaggtcgtgatatctggtggggatcttta
atggagaccgcatctgagcattgcattcctgaagagatgggtgccgaagatccgctattc
ttactctatacctcgggctccaccggtaatcctaaaggtgtgctgcacactacaggtggt
tacatggtttatgcggccatgactcacgagtacgtattcgactataaagaaaatgaagtc
tattggtgtacggctgatgttggctggatcacaggccactcttatatggtctacggacca
ctcgccaatggcgcgacagtgcttattcacgaaggtgtaccaaactatccaacccctgca
cgcttaggtgagatggttgaccgtcataaagtaaacattctatatacggctccaaccctt
attcgcgcactcatggctgaaggcaaagaacaattcgaagggtttgacggtagttcgtta
cgtattatgggatctgtcggtgagccgattaacccagaggcttggcgctggtataacgat
gttattggccatgaaaaatgcccaatcgtagatacttggtggcagactgaaactggcggc
atcttgatcagcccgctaccaggtgccacagataccaaacctggatccgcgactcgccca
ttctttggcgtacagccggctcttgtcgataatataggtaatatcgtcgaaggagctaac
gaaggtaacttagttatcttagactcttggcctggacagatgcgtacggtattcggcgac
cacgacagattcgtactcacctactttaaaaccttcagaggcatgtactttacaggtgat
ggcgctaggcgtgatgaagatggttactactggatcaccggccgtgtggatgatgtgatt
aatgtgtcggggcaccgcttaggtactgcagaagtagaaagcgcattggtcgcccatgaa
ctcgttgccgaagccgctgtagtaggttacccccatgacattaagggccaaggtatttac
gcctatgtcaccttaactaaaggctcggttgaaacagaggagcttcgtcaagaactgaga
cagtgggttcgtaaagagattggcgcactggcaacgccagatcttatccaatgggctggc
ggcttacctaagacacgttcaggtaagatcatgcgtcgcttcctgcgtaagattgccgca
aacgaggtcactaacctaggtgactcatcgactctcgcagatccagcggtaatcgatacc
ttgattgagactcgccttaatcgcagcgaatag

DBGET integrated database retrieval system