KEGG   Shewanella pealeana: Spea_2558Help
Entry
Spea_2558         CDS       T00606                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
spl  Shewanella pealeana
Pathway
spl00010  Glycolysis / Gluconeogenesis
spl00620  Pyruvate metabolism
spl00640  Propanoate metabolism
spl00680  Methane metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spea_2558
   00620 Pyruvate metabolism
    Spea_2558
   00640 Propanoate metabolism
    Spea_2558
  Energy metabolism
   00680 Methane metabolism
    Spea_2558
Enzymes [BR:spl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Spea_2558
Lipid biosynthesis proteins [BR:spl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Spea_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABV87878
JGI: Spea2558
UniProt: A8H5P1
Position
3113995..3115947
Genome map
AA seq 650 aa AA seqDB search
MSTQSLYKVPSEIAANALVNDEQYKKMYQESIVNPEGFWREHGNRIDWIKPFTKVKKTSF
DDHNLFIKWFYDGTLNASANCLDRHLENNADKLAIIWEGDDAKDQRTLTYGQLHAEVCKF
ANALRSQGVRRGDVVTVYMPMVPEAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNS
KVVITADEGVRAGRIIPLKANIDEALSHPDVNCVEKVIVMKRTGGDINWVEGRDIWWGSL
METASEHCIPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKENEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPTPARLGEMVDRHKVNILYTAPTL
IRALMAEGKEQFEGFDGSSLRIMGSVGEPINPEAWRWYNDVIGHEKCPIVDTWWQTETGG
ILISPLPGATDTKPGSATRPFFGVQPALVDNIGNIVEGANEGNLVILDSWPGQMRTVFGD
HDRFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHE
LVAEAAVVGYPHDIKGQGIYAYVTLTKGSVETEELRQELRQWVRKEIGALATPDLIQWAG
GLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIETRLNRSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtctctctataaagtaccaagtgaaatcgctgcaaacgcacttgtaaac
gatgaacaatataaaaaaatgtatcaggagtcgattgtaaaccctgaaggtttctggaga
gaacacggtaaccgtatcgactggatcaaaccttttactaaggtaaagaaaacctcattc
gatgaccacaatctatttatcaagtggttctatgacggcacgctcaatgcctctgctaac
tgtttagacaggcaccttgaaaacaatgccgataaattagcaattatctgggaaggtgat
gacgctaaagatcagcgcactctaacttacggccagcttcacgccgaagtttgtaaattc
gctaatgcacttcgtagccagggtgtacgtcgaggcgatgttgtgactgtttacatgcct
atggtgccagaggccgcagtcgccatgcttgcatgtgcccgaattggtgcaattcattcg
gttgtatttggtggcttctcaccggactctattgcttctcgcgttatcgatggcaactca
aaagtcgtcatcactgccgatgaaggcgttcgtgccggccgtatcattcctctaaaagcc
aatattgatgaagccctttctcaccctgatgtcaattgcgtcgaaaaagtgatcgtgatg
aaacgcacaggcggtgatattaactgggtagaaggtcgtgatatctggtggggatcttta
atggagaccgcatctgagcattgcattcctgaagagatgggtgccgaagatccgctattc
ttactctatacctcgggctccaccggtaatcctaaaggtgtgctgcacactacaggtggt
tacatggtttatgcggccatgactcacgagtacgtattcgactataaagaaaatgaagtc
tattggtgtacggctgatgttggctggatcacaggccactcttatatggtctacggacca
ctcgccaatggcgcgacagtgcttattcacgaaggtgtaccaaactatccaacccctgca
cgcttaggtgagatggttgaccgtcataaagtaaacattctatatacggctccaaccctt
attcgcgcactcatggctgaaggcaaagaacaattcgaagggtttgacggtagttcgtta
cgtattatgggatctgtcggtgagccgattaacccagaggcttggcgctggtataacgat
gttattggccatgaaaaatgcccaatcgtagatacttggtggcagactgaaactggcggc
atcttgatcagcccgctaccaggtgccacagataccaaacctggatccgcgactcgccca
ttctttggcgtacagccggctcttgtcgataatataggtaatatcgtcgaaggagctaac
gaaggtaacttagttatcttagactcttggcctggacagatgcgtacggtattcggcgac
cacgacagattcgtactcacctactttaaaaccttcagaggcatgtactttacaggtgat
ggcgctaggcgtgatgaagatggttactactggatcaccggccgtgtggatgatgtgatt
aatgtgtcggggcaccgcttaggtactgcagaagtagaaagcgcattggtcgcccatgaa
ctcgttgccgaagccgctgtagtaggttacccccatgacattaagggccaaggtatttac
gcctatgtcaccttaactaaaggctcggttgaaacagaggagcttcgtcaagaactgaga
cagtgggttcgtaaagagattggcgcactggcaacgccagatcttatccaatgggctggc
ggcttacctaagacacgttcaggtaagatcatgcgtcgcttcctgcgtaagattgccgca
aacgaggtcactaacctaggtgactcatcgactctcgcagatccagcggtaatcgatacc
ttgattgagactcgccttaatcgcagcgaatag

DBGET integrated database retrieval system