KEGG   Shewanella pealeana: Spea_2583Help
Entry
Spea_2583         CDS       T00606                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
spl  Shewanella pealeana
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:spl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3146167..3147831
Genome map
AA seq 554 aa AA seqDB search
MCSIFAILDIQSDAAPLRQVALEMSKLLRHRGPDWSGIYSSDKAILAHERLAIVDIEHGA
QPLLSQDGSIVLAVNGEIYNHKELKAELGDKYSYQTNSDCEVILALYQEYGTEFLDKLNG
IFAFVLYDKSKDTYLVGRDHMGIIPLYTGHDAEGNFYVASEMKALMPVCKTVETFTPGHY
LSSEKGELTQYYQRDWRDFAAVQDNPASAEDVRDALEAAVKRQLMSDVPYGVLLSGGLDS
SVISAITQTFAKRRIEDDGESNAWWPQLHSFAVGLEGAPDLIAAKKVADAIGTIHHEITF
TFQDGIDAIKDVIYHLETYDVTTIRAATPMYLMARKIKAMGIKMVLSGEGADELFGGYLY
FHKAPNAQAFHEELVRKLDKLHLFDCLRANKAMAAWGLEARVPFLDKEFMDVAMRTNPDA
KMSKNGKIEKHILREAFEHKLPKEVAWRQKEQFSDGVGYSWIDGLKDHAAERVDDLKLAN
AKFRFPYNTPETKEAYFYRTFFEELFPLPSAAETVPGGKSVACSTPEALAWDASLQGIID
PSGRAVQSVHDSAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttgcaattttagatattcaatccgacgcggctccactgcgtcaagtc
gctctagagatgtccaagcttctgcgtcatcgcggtccagattggtctgggatttacagc
agtgataaagcaattttagcccatgaacgtttagctattgtcgatattgaacacggcgca
cagccactgcttagccaagatggctctatcgtattggccgtaaacggtgagatctacaac
cacaaagagcttaaggccgagcttggtgataagtacagttaccaaacaaactcagactgc
gaagtgatcttggctctttatcaagagtatggcactgaattcttagataaactcaacgga
attttcgcctttgtgctttacgacaagtcaaaagacacgtatctggttggccgcgatcac
atgggtattattccgctctacaccggccacgatgcggaaggtaacttctacgttgcatct
gagatgaaagcactgatgccagtatgtaaaactgtcgaaacctttactccaggccattac
ctgtcaagtgagaaaggcgagcttacccaatactatcaacgtgactggcgcgattttgcc
gcagtgcaagataaccctgccagcgcggaagatgtgcgtgatgcattagaagctgcagta
aaacgccagctaatgtctgatgtaccttacggtgtattactctctggtggattggattca
tcagtgatttcagccatcactcaaacgttcgccaaacgtcgtatcgaagatgacggtgaa
agcaacgcatggtggccacagcttcactcatttgccgtcggtcttgaaggtgcacctgac
ttaattgctgcaaaaaaggtagccgatgccattggtaccattcaccatgaaattaccttt
accttccaagatggtatcgatgcgattaaagatgtgatttaccacttagaaacttacgat
gtcaccactattcgagcggctactcctatgtacttgatggcacgtaagatcaaggctatg
ggcattaagatggtgttatcgggtgaaggcgccgatgagttgttcggcggctacctctac
ttccataaagcgccaaacgcacaagccttccatgaagagcttgttcgtaaactcgataaa
ctacacctattcgactgtttgcgcgctaacaaagcgatggcggcatggggactcgaagct
cgcgtacctttcctagacaaagagtttatggatgtcgcgatgcgcactaaccctgatgca
aaaatgtcgaagaacggtaaaattgaaaagcatatcctgcgtgaagcctttgagcacaag
ttacctaaggaagtagcatggcgtcaaaaggagcagttcagtgacggtgtaggttactct
tggatcgatggccttaaagatcacgcagcagagagagtggacgatttaaaattggcaaac
gctaagtttagattcccatacaacacgccagaaaccaaagaagcttatttctaccgtacc
ttctttgaagagctgttcccattaccaagcgcagcagaaacggtaccaggtggtaaatca
gtagcctgctcgactccagaagccttagcgtgggatgcaagcctgcaaggcataatcgac
ccatcgggccgagcggtacaatcggtacacgacagcgcctactaa

DBGET integrated database retrieval system