KEGG   Shewanella pealeana: Spea_2879Help
Entry
Spea_2879         CDS       T00606                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
spl  Shewanella pealeana
Pathway
spl00900  Terpenoid backbone biosynthesis
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spea_2879
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Spea_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NmrA
Motif
Other DBs
NCBI-ProteinID: ABV88197
JGI: Spea2879
UniProt: A8H6L0
Position
complement(3517781..3518971)
Genome map
AA seq 396 aa AA seqDB search
MQNMVILGATGSIGASTLNVVACNPEQYKVFALVANTNVAKMLEICIAHQPKIAHMVDAK
AAQALKQQLPSHLKIEVTTGEDELLSLVSCSEVDTVMAAIVGAAGLPSTLAAVNAGKRVL
LANKESLVMSGQLFIEAMQNSGAQVLPVDSEHNAIFQCLSERSQLEIGRCDLTGAGVSHI
LLTGSGGPFLTSDLSSLVNMTPDQACKHPNWSMGRKISVDSATMMNKGLEYIEARWLFNA
SSDQLKVVIHPQSVIHSMVQYRDGSVLAQLGNPDMRTPIAHCMSFPQRISSGVEPLDFFK
VGQLSFLEPDFNRFPCLALAIEACKQGQEATTVLNAANEISVQAFLDGKIRFTDIAKINE
QSLMNTATHPLNCIDDILALDFQSRQYTLNAITKLN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatggtgattttaggcgcaacaggctccattggtgcaagcaccttgaatgtt
gtggcgtgtaatcctgagcagtacaaggtttttgcgttagtggcaaatactaatgtcgcc
aaaatgctagagatctgtattgcgcatcagcctaagattgcccatatggtcgatgcaaaa
gcggctcaagcgctcaagcagcaacttccaagtcatctcaaaattgaagtgactactggt
gaagatgagctgttgtctcttgtgagctgcagtgaggttgataccgtgatggcggccatt
gtcggcgccgcgggtctaccttcaactctcgccgcggttaatgcgggtaaacgagtattg
ctggctaacaaagaatcgttagtcatgtctggccagctgtttattgaagcgatgcaaaac
tctggcgcacaagtattgccggtagatagtgaacacaacgctattttccagtgtttatct
gagcgttcacagcttgagataggtcgttgtgacctaactggtgcaggggtttctcatatt
ttgctgacaggttctggtggtccgtttttaacctcagatttatcgtcactggtaaatatg
acgcctgatcaggcctgtaaacaccctaattggtctatggggcgtaagatctcggttgat
tctgcgaccatgatgaataaaggtctcgaatatattgaggcgcgttggttgtttaatgca
agtagcgaccagttaaaggttgtgattcaccctcaaagtgtgattcattctatggtgcaa
taccgtgatggctcagtgttagcgcaattggggaatccagatatgcgtacaccgattgcc
cattgtatgtcatttccacaaagaattagctcgggagttgaacctttagacttttttaaa
gtcggacagttaagcttcttagaacctgattttaataggttcccctgtttagcattggcg
atagaagcatgtaagcaagggcaagaagcgacaaccgtattaaacgccgccaatgaaatc
tctgtgcaggcatttttagatggcaagatccgctttaccgatatagcaaaaataaacgaa
caaagcttaatgaatacggcgacgcatccattaaactgtattgatgatatcttggcttta
gactttcaaagtcgtcaatacacattaaacgctattactaagctgaattag

DBGET integrated database retrieval system