KEGG   Shewanella pealeana: Spea_2964Help
Entry
Spea_2964         CDS       T00606                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spl  Shewanella pealeana
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Spea_2964
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Spea_2964
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Spea_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3628609..3629091
Genome map
AA seq 160 aa AA seqDB search
MTASIYDFSVNNIQGKTVSLANFKDKVILIVNTASECGFTPQYKELEALYQKHQSQGLAV
LGFPCNQFGEQEKGDNQAISSFCELNFGVTFPLFEKIEVNGANTAPLYAHLKQSAKGLLG
SEAIKWNFTKFLVDRQGKVTQRFAPTTKPMAIEGEILKLL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttccatttacgatttttcagttaacaatattcagggaaaaacggtttcactg
gcgaactttaaagacaaagtcatattgattgttaatacagccagcgaatgtggctttacg
cctcaatataaggagcttgaggctctgtaccaaaaacaccagtctcaagggctggcggtg
cttgggtttccatgtaaccagtttggcgagcaagaaaaaggggataaccaagccattagc
tcattttgtgaattaaattttggtgtgaccttcccactatttgaaaaaattgaagtaaat
ggcgccaataccgctccactgtatgcacatttaaagcaatctgctaaaggcttactgggt
tctgaagcaataaagtggaactttaccaagtttttagtcgataggcagggcaaagtcacc
caacgctttgcgccaacgacgaagccaatggcaattgaaggtgaaatattaaagctactt
tag

DBGET integrated database retrieval system