KEGG   Shewanella pealeana: Spea_3064Help
Entry
Spea_3064         CDS       T00606                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spl  Shewanella pealeana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spea_3064
   01230 Biosynthesis of amino acids
    Spea_3064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spea_3064
   00051 Fructose and mannose metabolism
    Spea_3064
   00562 Inositol phosphate metabolism
    Spea_3064
Enzymes [BR:spl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spea_3064
Exosome [BR:spl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spea_3064
  Exosomal proteins of bladder cancer cells
   Spea_3064
  Exosomal proteins of melanoma cells
   Spea_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3758701..3759483)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFNKFATKLQDDSVEVVLCPPSIYLESVRQLLDENKE
TLNGCLVRMGTQNLSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNATEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacttagacgtcccatggttgctggtaattggaaaatgaacggcagtgcgcagttg
gcgcaagagctattcaataagttcgctaccaagctccaagatgattcagtggaagtggtt
ttgtgtccaccttctatttacttagagagtgttcgacaactactagatgaaaataaagaa
accttaaatggttgcttagtcagaatgggaactcaaaacctaagtcaacatgactttgga
gcctatactggtgaaatatctggtcagatgttaaaggattcaggatgtcgatatgttatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaacatagtggcagagaaa
tttgctgcagctcagaaacatggtttgaccccaatattatgtgttggtgagtcgggtcca
gctcgtgaagcgagacgcacttttgaagtgatcgccgaagagttagatgtggtcattgaa
aagaatggcaccatggcttttgacaacgctattatcgcttacgagccattatgggcagta
gggacaggtaagagtgctacgccagagcaggctcaagaagttcatgcgtttatccgcaaa
cgcctctctgaagtatctccatttatcggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaatgcagcagacttgtttgctcaacctgatgtagacggtggattgatt
ggcggtgtaagcctcaatgctaccgaatttctcagtttatgtacgatagcgatgagcgca
taa

DBGET integrated database retrieval system