KEGG   Shewanella pealeana: Spea_3129Help
Entry
Spea_3129         CDS       T00606                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spl  Shewanella pealeana
Pathway
spl00900  Terpenoid backbone biosynthesis
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spea_3129
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spea_3129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABV88445
JGI: Spea3129
UniProt: A8H7A8
Position
3832224..3833078
Genome map
AA seq 284 aa AA seqDB search
MTASLSLGWPAPAKLNLFLHINAQRHDGYHELQTLFQFIEHCDYLDFKVLDTPKLKLHSN
MSSAVADSDNLILKAAKSLQQRTDCQLGAEIWLDKRLPMGGGLGGGSSDAATTLVALNQL
WETGLSLRELGEIGLKLGADVPVFINGFSAFAEGVGEKLQNVEPAEPWYLVLTPQVHVST
AEVFQDPDLPRNTPKLSLESLMNSPWQNDCQTLVAKRYPQVAKTLAWLLEYAPSRMTGTG
ACVFGQFEQEQEAKDVLAKLPASIQGFVAKGANISPLMLRLAQC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgtcactttcattaggctggccggctccggctaaactaaacctatttctacat
atcaacgctcagcgtcatgacggctatcacgaactgcaaactctgtttcagtttatcgaa
cattgtgactatctagacttcaaagtgttagatacgccaaagctgaaattacattcgaat
atgtcatcagctgttgccgacagcgataacttaattctcaaagccgcaaaatcgctgcaa
caacgaacagattgtcagctaggggctgaaatttggctagataaacgccttcctatgggc
ggcggtctcggcggcggttcctccgacgcagccaccacgctagtcgcacttaatcaacta
tgggaaacaggattgtcgctacgagagctcggtgaaataggcttaaagcttggcgcagat
gttcctgtttttattaatggtttttcagcatttgccgaaggtgtaggcgaaaaattgcaa
aacgttgagcccgccgagccttggtatctggtgttgactccccaagtacatgtttctacg
gctgaagtctttcaagacccagacctacctcgaaacacgccaaagttaagtctcgagtca
ttgatgaacagcccatggcaaaatgactgccaaacattagtcgcaaaacgctaccctcaa
gttgccaaaaccttagcgtggctgctagaatatgcgccgtccagaatgaccggaacagga
gcatgtgtttttggtcaattcgaacaggagcaagaagctaaagatgtattggcgaagttg
cctgcatcgatacaaggctttgttgcgaaaggggcaaatatatcaccgttgatgctgaga
ttagctcagtgttaa

DBGET integrated database retrieval system