KEGG   Shewanella pealeana: Spea_3801Help
Entry
Spea_3801         CDS       T00606                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
spl  Shewanella pealeana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Spea_3801
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Spea_3801
Exosome [BR:spl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spea_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4615072..4616082
Genome map
AA seq 336 aa AA seqDB search
MNIITSAYPQRRMRRMRKHEFSRRLMAENQLSVNDLIYPMFVLEGNNRTEQVASMPGVER
LSIDLLLKEAEELVELGIPLIALFPVTPAEKKTLMAEEAYNADALAQRAVRALKEAFPQL
GVMTDVALDPFTTHGQDGIIDDTGYIMNDITTEILVKQALSHAEAGADIVAPSDMMDGRI
GAIRKALEEAGHVNTQIMAYSAKYSSNYYGPFRDAVGSAGNLKGGNKHSYQMDPANSDEA
LHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAYQVSGEYAMHMAAIQNGWLA
EKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEDK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattattactagtgcctacccacaacgtagaatgcgccgtatgcgtaaacatgag
tttagtcgccgtctaatggctgaaaatcagctatcagtaaatgacttaatctaccctatg
tttgtcttagaaggtaacaaccgcacagagcaagttgcttcaatgcctggtgtagagcgc
ctttcaattgacctattacttaaagaagctgaagagcttgttgagctaggtattcctcta
attgcattattcccagtcactccagctgagaagaaaactttaatggctgaagaagcctat
aatgccgatgcgctagcccaacgtgcagttcgtgcactgaaagaagcattccctcagctt
ggcgtcatgacagacgttgcactcgacccattcacgacacatggtcaagatgggattatc
gatgatactggctatatcatgaatgatatcaccacagagatcttggttaaacaggccctg
tctcatgctgaagctggagctgatatcgtcgccccctcagacatgatggatggccgtatt
ggtgctattcgtaaagcacttgaagaagctggccatgtgaatacacagatcatggcgtac
tcagcaaagtactcttctaattactacggccctttccgtgatgcagttggctctgcaggc
aacctaaaaggtggcaataagcatagctaccagatggatccagcaaatagcgatgaagca
ctacatgaagttgctttagacatccaagaaggcgctgatatggtcatggttaagcctggt
atgccatacctagacatagtgcatcgcgtaaagaccgaactagcagtacctacgtttgct
taccaggtaagtggcgaatacgcgatgcatatggcagcgattcaaaacggttggttagct
gagaaggcgatcgttatggaatcgctactttgctttaagcgtgcaggcgccgatggcatc
ctaacctatttcgctaaacgtgccgctcaatggttaaaagaagacaaataa

DBGET integrated database retrieval system