KEGG   Shewanella pealeana: Spea_3822Help
Entry
Spea_3822         CDS       T00606                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spl  Shewanella pealeana
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spea_3822
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spea_3822
Exosome [BR:spl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spea_3822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4645886..4647367)
Genome map
AA seq 493 aa AA seqDB search
MSKKYIIALDQGTTSSRAIVFDHDTKMVASSQREFSQMYPQPGWVEHDAMEIWASQSSTL
IEVLARADIHSEDVAAIGITNQRETTVVWDKVTGKPVYNAIVWQCRRSKAICDELKAQGL
EDYIKQTTGLVLDPYFSGTKIKWILDNVEGVRERAEKGELLFGTIDTWLVWKLTEGKVHV
TDPTNASRTMLFNIHTQQWDDKLLDAFDIPRSILPEVKPSSAIYGYTRIAGEGSHIAIAG
MAGDQQSALFGQLCIEEGMAKNTYGTGCFLLMNTGVEAVQSQHGLLTTIAIGADGGINYA
LEGSVFMGGATVQWLRDELGLIRDAQDTEYFAKKVEDTNGVYLIPAFVGLGAPYWDPDAR
GALVGLTRGANRNHIIRAALEAIAYQSRDLLDAMSKDSCVELKQIKVDGGAVANDFLMQF
QADITNVEVLRPELTETTALGAAFLAGLAVGFWDSTDELKHKAGIERNFTPQISMQKRDS
LYKGWQEAVTRTR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagaaatacatcatagcactggaccaagggacaacgagctcccgagcgatagtg
ttcgatcatgataccaagatggttgctagctcacagcgtgagtttagccaaatgtatcct
caaccgggttgggttgaacatgatgcgatggagatctgggcgtctcaaagctcaactctt
attgaagtattagcgcgggcggatattcacagtgaagatgtggcggctatcggcattact
aatcagagagaaacgacagtcgtttgggacaaggtaacgggtaagcctgtttacaacgca
atcgtatggcagtgccgacgcagtaaagccatttgtgacgagctcaaagcgcaagggtta
gaagattacattaagcagactacaggcttggtactcgatccttatttttcaggcaccaag
attaagtggattttggataacgtcgaaggtgtgcgggagcgagcagagaaaggtgagcta
ctgtttggcaccatagatacctggcttgtttggaagctcactgagggcaaggttcatgtt
accgatccgaccaatgcttcacggaccatgttattcaatattcatactcagcagtgggac
gacaagctactagatgcatttgatattccgcgctcaatactgccagaggtaaagccttcg
tcggctatctatggttatacccgtatagcgggggaaggtagtcacattgccattgctggg
atggcgggagatcagcagtcggccttgtttggtcagctctgcatcgaagaaggcatggca
aaaaacacttatggtacaggctgtttcttgctgatgaatactggtgtcgaagccgttcag
tctcagcacggattgttaaccaccattgcgattggagccgacggtggaattaactatgca
ttagagggctcggtatttatgggcggagctacagtgcaatggcttagggatgagttgggg
cttattcgtgatgcacaagataccgaatactttgctaaaaaagttgaagatactaatggt
gtgtatctgatcccggcattcgttggattaggcgctccctattgggaccctgacgcgaga
ggagcgttagtgggcttaacccgaggggctaatcgtaaccatattattcgtgctgcactg
gaggctattgcatatcagagccgcgacctattggatgccatgtctaaagatagttgtgtc
gagctgaagcagattaaggtcgacggcggcgcggtggcgaatgacttcctgatgcagttt
caggccgatattactaacgttgaggttttgcgcccagagctgactgaaacaactgcactg
ggagcggcatttctggcaggtctagcggtgggcttctgggactctaccgatgaactaaag
cataaggctggcatcgagcgtaactttacaccacagatcagcatgcaaaagcgcgatagt
ctatacaaaggttggcaagaggctgtgacccggacacgttaa

DBGET integrated database retrieval system