KEGG   Shewanella pealeana: Spea_3877Help
Entry
Spea_3877         CDS       T00606                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
spl  Shewanella pealeana
Pathway
spl00230  Purine metabolism
spl01100  Metabolic pathways
Module
spl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Spea_3877
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Spea_3877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase MMR_HSR1 ABC_tran AAA_33 AAA_18 AAA_29 Lactonase AAA_22
Motif
Other DBs
NCBI-ProteinID: ABV89187
JGI: Spea3877
UniProt: A8H9F0
Position
4723151..4723783
Genome map
AA seq 210 aa AA seqDB search
MQLMTARGNLFIVSAPSGAGKSSLISALLRDQPVDMQVSVSHTTRQPRPGEENGQHYHFV
NQDEFKSLIADGAFFEWAEVFGNYYGTSRVTIEQTLAQGIDVFLDIDWQGAQQVKELMPE
SIGVFILPPSKTELERRLTGRGQDTAEVIAGRMAQAVSEMSHYNEYDFVIVNDDFDKALA
DLLAIIRSQRLTSASQIHTQNGMIKDLLAG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcagctaatgaccgctcgcggaaacctatttatcgtctcggcgccaagtggcgcaggt
aaatcatcgcttatttcggccctgttacgagaccagcctgtagatatgcaagtttcagtt
tcgcacaccacaaggcagccgcgtccaggtgaagagaatggtcagcactatcacttcgtt
aatcaagacgagtttaagagcttaattgccgatggcgctttttttgagtgggcagaagta
tttggtaactattatggcacctctcgtgtcacgattgagcaaacactcgcgcaaggtatc
gacgtctttctcgatatcgactggcagggtgcgcagcaagttaaagagctgatgcctgaa
tcgattggcgttttcattctcccgccgtcaaaaactgagctagaacgccgcctaacaggc
cgcggacaagacaccgctgaagtgattgcgggccgcatggcacaggcggtttcagagatg
tcacactacaatgaatatgacttcgttattgttaacgatgatttcgacaaagcattagcc
gatttattagcgatcattcgcagccaaagattaacctctgctagccaaattcatacgcag
aatggtatgattaaagatctgttggcaggctaa

DBGET integrated database retrieval system