KEGG   Shewanella pealeana: Spea_4104Help
Entry
Spea_4104         CDS       T00606                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spl  Shewanella pealeana
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:spl00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Spea_4104
Enzymes [BR:spl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Spea_4104
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Spea_4104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4991397..4992212
Genome map
AA seq 271 aa AA seqDB search
MPELPEVEVTRQGVSPYLIDNTVTDLIVRNPSLRWPVPEIAKQIIGQTIRNVRRRAKYLL
IDTDAGTTIVHLGMSGSLRILPATTPAEKHDHIDLVLASGKALRFNDPRRFGAWLWCELP
EQAHPLLSKLGPEPLTDAFNAPYLLESLANKKKAIKLCLMDNHIVVGVGNIYANEALFAA
GIHPQAEAGKVDAERIEILVSEVKQILAGAIKQGGTTLKDFTNADGKPGYFAQKLHVYGR
GGKTCTQCGHMLSEIKLGQRATVFCSLCQQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactccccgaagttgaagtgactcgacaaggcgtatccccctatctcatcgac
aacacagttaccgacttaatcgtgcgtaatccatcactcagatggcctgtgcctgagata
gccaaacagatcatcggccagacgattcgcaatgtgcgccgccgtgctaaataccttctt
atcgataccgatgcgggcaccaccattgtgcatctggggatgtcgggcagcttacgaata
ctgcctgctaccacaccggcagagaaacacgatcatatcgatctggtgctagcgagtggt
aaagccctgcgctttaacgacccgagacgcttcggtgcttggctatggtgtgaactgcct
gaacaagcccatccattattgtcaaaattaggcccagaacctctcactgacgcttttaac
gctccttacctattagagagtttggccaataagaagaaggccataaagctgtgcttaatg
gacaatcatatcgtggttggcgtaggtaatatttacgctaacgaggcgctgtttgccgct
ggtattcatccgcaagcagaagcaggtaaagtcgatgccgagcgtatcgagatcttagtc
agtgaagtaaaacaaatcttggcgggcgcgattaaacagggcggtacaacacttaaggac
tttaccaatgccgatggtaaaccgggctactttgcccagaagctacatgtttacggccgc
ggcggcaaaacctgcactcagtgtggccacatgctcagtgaaattaaactcggccaacgg
gcaacggttttctgtagcttgtgccagcaaagataa

DBGET integrated database retrieval system