KEGG   Shewanella pealeana: Spea_4164Help
Entry
Spea_4164         CDS       T00606                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
spl  Shewanella pealeana
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Spea_4164
Enzymes [BR:spl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Spea_4164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5055063..5056082
Genome map
AA seq 339 aa AA seqDB search
MLTDKYPKAQLAHTPTPFEFMANMTKKFDGPKLWIKRDDATGLAMGGNKARQLEFYVGKA
QADGCDTLLTTGAVQSNHVRMTVAAARKMGWHVEVQLEHRVDGRLPEYEDSGNPFLDKLM
GAKIHNYPVGEDENGADQVMYDRADELAEEGYKPFVIPLGAVGKTPWGALGYVDCVEELL
LQAQATGMKIDAIVLPTGSANTHAGVLAGLIALNSDIPVYGFCVRRDKVAQFERVLVKTR
KVLQLLGVDENKATHDLVKCEDWVLGPGYGQLTTEVHEAIEILGHEEGILLDPTYTAKSM
AGMIGMIRDGQFTKDQNVVFLHTGGTPALFGYPELIANK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcttactgataaataccctaaagctcaattagctcacactccaacccctttcgaattt
atggccaatatgaccaagaaattcgatggccctaaattatggattaaacgtgacgatgca
actggcttagccatgggtggtaacaaggctcgtcaattagagttttacgttggtaaggct
caagccgatggttgtgacaccctactcaccacaggtgcggttcagtctaaccacgttcgt
atgactgttgcagcagcacgtaagatgggctggcatgttgaagtacagctagagcaccgt
gttgatggccgactacctgagtacgaagatagcggtaacccattcctagataaattaatg
ggcgcaaaaattcacaactatccagtaggtgaagatgagaacggtgcggatcaggtgatg
tatgacagagccgacgagctagcggaagagggctacaagccgttcgttattccactaggc
gctgtaggtaaaacaccttggggcgcactaggttatgttgactgtgttgaagagttattg
cttcaagcgcaagcgactggcatgaagatcgatgccatcgtattaccaacaggctcagct
aacacccacgcaggtgttttagctggcttaatcgcgctaaacagcgatatcccagtatat
ggtttctgtgttcgccgcgataaagtagctcagttcgagcgtgtattagttaagactcgc
aaagtactgcaactgcttggtgttgatgaaaataaagcgactcacgacttagttaagtgt
gaagattgggtgcttggccctggatatggccaattgacgactgaagttcatgaagcaatc
gagattttaggtcatgaagaagggatattattagaccctacctacacagctaagagcatg
gctggcatgatcggcatgatccgcgacggtcaattcactaaagatcagaacgtcgtcttt
ttacacacaggtggtacaccagccctattcggctacccagaactgattgccaataagtaa

DBGET integrated database retrieval system