KEGG   Serratia plymuthica PRI-2C: Q5A_022075Help
Entry
Q5A_022075        CDS       T04576                                 

Gene name
scrB
Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00052  Galactose metabolism
sply00500  Starch and sucrose metabolism
sply01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sply00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Q5A_022075 (scrB)
   00500 Starch and sucrose metabolism
    Q5A_022075 (scrB)
Enzymes [BR:sply01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Q5A_022075 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ANS44832
UniProt: A0A1B1KWK3
Position
4730326..4731735
Genome map
AA seq 469 aa AA seqDB search
MEELNLMKQAVQALMDGMPLALRDPHRPAWHLAPSVGLLNDPNGFIQHKGVYHLFYQWNP
LGCDHRNKCWGHWQSTDLLNWQHQPVALVPGACYDSHGCYSGSAVVADGKIMLAYTGNVK
YPDGSRTAYQCLALENELGRYDKLGPVLPLPEGYSGHVRDPKVWRHQDSWYMVLGARDLQ
DRGKVLLLRSTDLRSWQLLGEIAGTQLNGMGDFGYMWECPDLFTLAGTEVLICCPQGLAA
QAERYLNVYQAGYLTGKLDYRQASFEHGEFHELDAGFEFYAPQTTLAEDGRRLLVGWMGV
PEQDETCHPTLQYGWIHTMTCPRELSLHNGKLYQQPARELQRLRGEGSQWQGIADNAPGW
PVDSAEVLLTPNGPFSADFGDAMTLSWDGALLRLTRNNLCTGQPEHRYWRGEVTHLQMLF
DSSSVEIFINHGEGVMSSRYFPGPQPLLRLNGETQLALEHWPLTPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgaatttgatgaaacaggccgttcaggcgttgatggacggcatgccgctg
gcgctgcgcgatcctcaccggccggcatggcacctggcccccagcgtcggcctgctgaac
gaccccaacgggtttattcagcataagggggtttatcacctgttctatcaatggaacccg
ctgggttgcgaccaccgcaacaaatgctggggccattggcaatcgacggatctgttgaac
tggcagcatcagccggtggcgctggtgcctggcgcctgttacgacagccacggctgttac
tcaggctcggcggtggtggcagacggcaaaatcatgctggcgtataccggcaacgtaaaa
taccccgacggctcacgcaccgcgtaccagtgcctggcgctggaaaatgagctgggcagg
tatgacaagctcggcccggtgctgccgctgccggaaggctacagcggccacgtgcgcgat
cccaaggtttggcgccatcaagacagctggtacatggtgctcggtgcccgtgatctgcag
gatcgcggcaaggtgctgttgctgcgctccaccgatctgcgcagttggcagctgttgggg
gaaattgccggcacacagctgaacggcatgggcgatttcggctatatgtgggaatgcccg
gatctgttcacgctggcaggcaccgaggtgttgatttgttgcccgcaggggctggcggcg
caggctgagcgttatctcaacgtttaccaggcgggctatctgaccggcaagctggattat
cggcaggcgagctttgaacatggcgaattccacgagctggacgccggattcgaattctat
gcgccgcaaaccacgctggccgaagacggccgccgtctgctggtcggctggatgggcgta
cctgaacaggacgaaacctgccacccgacgttgcaatacggttggatccacaccatgacc
tgcccgcgcgagctgtcgttgcacaacggcaagctttaccaacaaccggcgcgcgagctg
caacgtctgcgcggcgagggcagccaatggcagggaatagcggataacgcgccgggctgg
ccggtcgacagtgccgaagtgctgttgacgcccaacggccctttcagcgccgactttggc
gatgcgatgacgctgagctgggacggcgccttgctgcgtctgacgcgcaacaacctgtgc
actgggcaacctgaacaccgttactggcgtggtgaggtcacccatctgcaaatgctgttc
gacagctccagcgtggagatttttatcaaccacggcgaaggggtcatgagttcacgctac
ttccctggcccgcagccgctgctgcgtttgaacggcgagacgcagcttgcgctggagcac
tggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system