KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0043Help
Entry
spyM18_0043       CDS       T00079                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    spyM18_0043 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spyM18_0043 (adhE)
   00620 Pyruvate metabolism
    spyM18_0043 (adhE)
   00650 Butanoate metabolism
    spyM18_0043 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    spyM18_0043 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    spyM18_0043 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    spyM18_0043 (adhE)
   00626 Naphthalene degradation
    spyM18_0043 (adhE)
Enzymes [BR:spm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     spyM18_0043 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     spyM18_0043 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58575..61217
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDNFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPATWIAAQAGFTVPEGTNILAAECTEVSEKEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFDNLEKSVKTADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIQMNFKAQGIDENEWKEHSRELA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataatactgttgaaacaacctctgtttctgtgacaattgatgctctt
gttcaaaaaggtttagctgctcttgaagagatgcgtaagcttgaccaagaacaagttgat
tatatcgtagccaaagcttctgttgctgctttggatgctcacggtgaacttgctaaacat
gcttatgaagaaacaggtcgcggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtaggaattattgaagaagat
gatgtgacaggtttgacattaattgctgagccggtgggtgttatctgtgggattacacca
acaactaacccaacttcaacagctatctttaaatctttgatctcgttaaaaacacgtaat
ccaattatttttgcctttcacccatcagcacaagaatcatcagcgcatgccgctcgtatt
gttcgtgatgctgctattgccgctggtgctcctgaaaattgtgtgcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgacggcattgccactatccttgcg
acaggtggaaatgcgatggttaaagcggcatactcatgtgggaaacctgcccttggggta
ggtgctggtaacgttccagcttatgttgaaaaatcagctaatatccgtcaagccgctcat
gatattgtgatgtctaaatcatttgataatggtatggtctgtgcctctgaacaagctgtt
atcatcgataaagaaatctatgacaattttgtagcagaattcaaatcttaccacacttat
tttgttaataaaaaagaaaaagcccttcttgaagaattctgttttggtgcaaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgtaggaaaaccagctacttgg
attgcagcacaagctggatttactgttccagaaggaacaaatattcttgccgcagaatgt
actgaagttagtgaaaaagaacctttgacacgggaaaaattatcaccagtcattgctgtt
ttgaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggacttggtcactcagctgccattcatacagcagatgcagagttggcaaaagaatttgga
actagaatccgtgctatccgcgtcatctggaattcaccttctacatttggtggtatcggg
gatgtttacaatgctttcttaccatcattgactcttggttgtggttcgtatggacgtaac
gcagttggtgataacgttagtgctataaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgtgattcaatt
caatatttgcaaaaatgtcgtgatgttgaacgtgtcatgattgttacagatcacgctatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatctttgctgaagtagaaccagatccagacattacaactgttatgaaaggt
actgaattaatgcgtaccttcaaaccagacaccattattgcccttggcgggggatctcct
atggatgcagccaaagttatgtggctcttttatgaacaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgcaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctatcccaacaacttctggaacaggttcagaggtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattactcattaaca
ccaactgtagccattgttgacccagctttggtattgactgttccaggctttattgctgct
gatactggtatggacgttttgacacacgcaaccgaagcttacgtgtcacaaatggccaat
gactttacggatggtttagctcttcaagccattaaaattgtttttgataatcttgaaaaa
tcagttaaaacagccgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacggcgacatggcctaagtataattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttagggcttccagcttctacaccagaagaa
gcagtggaatcttatgcgaaagctgtttatgatctgggttgccgagttggtattcaaatg
aacttcaaagctcaaggtatcgacgaaaatgaatggaaagaacattctcgtgaattggct
taccttgcttatgaagaccaatgttcacctgctaacccacgtcttccaatggttgatcac
atgcaagaaattattgaagatgcttactatggttatgctgaacgtccaggacgacgtaag
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system