KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0556Help
Entry
spyM18_0556       CDS       T00079                                 

Gene name
coaE
Definition
dephospho-CoA kinase (EC:2.7.1.24)
Orthology
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:spm00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441731..442324
Genome map
AA seq 197 aa AA seqDB search
MIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHDLQEKGGRLYEALREAFGNQILKAD
GELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELAAKRDHLAQSQAIFFMDIPLLMELGY
QDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQRIASQLPIEEKKPYASLVIDNNGDME
TLIKQVQSALLSLANPR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgattattggcatcacaggaggcattgcatcaggaaaatcgactgtggttaaggtcatt
agaaaagctggttatcaggtgattgatgcggatcaagtggtccatgacttgcaagaaaaa
ggcggtcgtctttacgaggctcttagagaagcttttgggaatcagattttaaaagcagat
ggtgagttagatcgcacaaagctgtcagaaatgcttttttcaaacccagataatatggca
acatcctcagccattcaaaatcaaatcattaaggaagaattggcggctaagcgtgaccac
ttagcacagagccaagccatttttttcatggatattccccttttaatggaattgggctac
caagactggtttgatgcgatttggctggtttatgtagatgctcagacacaattgcagcgc
ttaatggctagaaatcgtttagacaaaggaaaagcaaggcagcgaatagccagtcagtta
ccaatagaggaaaaaaagccctatgccagtctagtgattgataataatggagacatggaa
acgttaataaagcaagtacaatctgcgttgttgtcattagccaatccgaggtag

DBGET integrated database retrieval system