KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0556Help
Entry
spyM18_0556       CDS       T00079                                 

Gene name
coaE
Definition
dephospho-CoA kinase (EC:2.7.1.24)
Orthology
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    spyM18_0556 (coaE)
Enzymes [BR:spm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     spyM18_0556 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441731..442324
Genome map
AA seq 197 aa AA seqDB search
MIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHDLQEKGGRLYEALREAFGNQILKAD
GELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELAAKRDHLAQSQAIFFMDIPLLMELGY
QDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQRIASQLPIEEKKPYASLVIDNNGDME
TLIKQVQSALLSLANPR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgattattggcatcacaggaggcattgcatcaggaaaatcgactgtggttaaggtcatt
agaaaagctggttatcaggtgattgatgcggatcaagtggtccatgacttgcaagaaaaa
ggcggtcgtctttacgaggctcttagagaagcttttgggaatcagattttaaaagcagat
ggtgagttagatcgcacaaagctgtcagaaatgcttttttcaaacccagataatatggca
acatcctcagccattcaaaatcaaatcattaaggaagaattggcggctaagcgtgaccac
ttagcacagagccaagccatttttttcatggatattccccttttaatggaattgggctac
caagactggtttgatgcgatttggctggtttatgtagatgctcagacacaattgcagcgc
ttaatggctagaaatcgtttagacaaaggaaaagcaaggcagcgaatagccagtcagtta
ccaatagaggaaaaaaagccctatgccagtctagtgattgataataatggagacatggaa
acgttaataaagcaagtacaatctgcgttgttgtcattagccaatccgaggtag

DBGET integrated database retrieval system