KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0590Help
Entry
spyM18_0590       CDS       T00079                                 

Definition
acetyl-CoA c-acetyltransferase
Orthology
K00680  
[EC:2.3.1.-]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Tyrosine metabolism
Benzoate degradation
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    spyM18_0590
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    spyM18_0590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    spyM18_0590
   00627 Aminobenzoate degradation
    spyM18_0590
   00642 Ethylbenzene degradation
    spyM18_0590
Enzymes [BR:spm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     spyM18_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471326..472474
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGVALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREYGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLAKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRCNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgtagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagtatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaaggtcacgtg
attagtgcagccaatgcctgcctcacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgatcgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggcaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctgtaatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system