KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0672Help
Entry
spyM18_0672       CDS       T00079                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    spyM18_0672 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    spyM18_0672 (bsaA)
Enzymes [BR:spm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     spyM18_0672 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(533624..534127)
Genome map
AA seq 167 aa AA seqDB search
MPNLYDFTVKAQNGNDLSLAAYKEKVVLIVNTATKCGLTPQYQALQALYDTYHDKGFEVL
DFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGK
RIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLDKIQCYHHL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctctatgattttacggttaaggctcaaaacgggaatgacctttccttagct
gcttataaagaaaaggttgttttgattgttaatacagctaccaagtgtggattaacccca
caataccaggccttgcaagcactatatgacacataccatgacaagggatttgaggtctta
gattttccttgcaaccaatttttaaatcaagctccaggagatgctgaggagattaatcac
ttttgcagtctgacctatcatactactttccctcgctttgctaaaatcaaagtgaatggt
aaagacgctgatcctttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaa
cgcatcgaatggaatttcactaaatttctcattgaccaaaatggtcaagtcattaaacgc
tattcctcaaagacagatcctaaactaattgaagaagaccttaaagcacttcttgataaa
attcaatgctatcaccatctttaa

DBGET integrated database retrieval system