KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0680Help
Entry
spyM18_0680       CDS       T00079                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    spyM18_0680 (tpiA)
   01230 Biosynthesis of amino acids
    spyM18_0680 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spyM18_0680 (tpiA)
   00051 Fructose and mannose metabolism
    spyM18_0680 (tpiA)
   00562 Inositol phosphate metabolism
    spyM18_0680 (tpiA)
Enzymes [BR:spm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     spyM18_0680 (tpiA)
Exosome [BR:spm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   spyM18_0680 (tpiA)
  Exosomal proteins of bladder cancer cells
   spyM18_0680 (tpiA)
  Exosomal proteins of melanoma cells
   spyM18_0680 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542111..542869
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIICCGESLETYEAGKAAEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattatttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gctgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgacgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggctctgtaaaacctgaaaatgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctgatagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system