KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0892Help
Entry
spyM18_0892       CDS       T00079                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:spm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723176..724111
Genome map
AA seq 311 aa AA seqDB search
MSVVNNRVALTNLVSMEALTTEEVLGLINRGSEYKAGKVVISDHQKDLVANLFFENSTRT
HKSFEVAEKKLGLTVLDFNADASAVNKGESLYDTVLTMSALGTDICVIRHPEDDYYKELV
ESPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGRFEGLKIAIAGDLTHSRVAKSNMQI
LKRLGAELYFYGPEEWYSEAFNAYGTYIAIDQIIKELDVLMLLRVQHERHDGHQSFSKEG
YHQAFGLTQERYQQLKDSAIIMHPAPVNRDVEIADSLVEAPKARIVSQMANGVFVRMAII
EAILNGRNKNL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgtaaataatcgcgttgcacttaccaatttagtttcaatggaagcattaacc
accgaagaagttttaggtcttatcaaccgtggttcagaatataaggctggtaaggttgtt
atttcggatcatcaaaaggatcttgttgccaatttattctttgaaaactccacccgaacc
cataagtcttttgaagtggctgagaagaaactcggcttgacagttcttgatttcaatgct
gatgcaagtgcggttaacaagggagaaagtttgtatgatactgtgttaaccatgagtgca
cttggaacagacatctgtgtgattcgtcacccagaagatgattattacaaggaattagta
gaaagtccaactattacagcttccattgtcaatggaggagatggttctggacaacacccg
agtcaatgtttacttgacttattaaccatctatgaagaatttggacgctttgaaggctta
aagattgcgatcgctggtgacttaactcactctagggtggcaaagtccaacatgcaaatc
ctcaaaagattaggagcagagctttatttctatggacctgaagaatggtattcagaagcc
tttaatgcttacggcacttatattgctattgaccagattattaaggaattggatgttctt
atgttgctgcgtgtacagcacgaacgccatgacggccatcagagtttttcaaaagaaggt
taccatcaagcgtttggattgacacaggaacgttaccaacaattaaaagattctgctatt
attatgcatccagctccagttaatcgggatgtggaaattgcagatagtttggtggaagct
cctaaagcgagaattgtatctcagatggctaatggtgtctttgttcgcatggctattatt
gaagccattttgaatggtagaaataaaaacttatga

DBGET integrated database retrieval system