KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0944Help
Entry
spyM18_0944       CDS       T00079                                 

Gene name
dfr
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    spyM18_0944 (dfr)
   00670 One carbon pool by folate
    spyM18_0944 (dfr)
Enzymes [BR:spm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     spyM18_0944 (dfr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772133..772630
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGVAGKLPWYLPKELEHFKKTTLHQAILMGRVTFEGMNCKRLSQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQEKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPNLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtgttgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcaatcttaatgggccgggtgacttttgaaggaatgaattgcaaaagactttctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggaaaaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttatttcgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgaccaaatctagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system