KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1060Help
Entry
spyM18_1060       CDS       T00079                                 

Gene name
folP
Definition
dihyropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
878482..879282
Genome map
AA seq 266 aa AA seqDB search
MKIGRFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSATDEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFG
FAKSVQQNTELLKGLDRVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaggtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcac
gttgagcaaatgattgctgatggtgctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctaccgatgaaattgacagggtggttcctgtgatcaag
gccatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggtcaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacagaatacggagttattaaaaggattggaccgcgtctgtcag
ttgggctatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggc
ggcaataccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gtgttgagccagttgatgtga

DBGET integrated database retrieval system