KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1062Help
Entry
spyM18_1062       CDS       T00079                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    spyM18_1062 (folK)
Enzymes [BR:spm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     spyM18_1062 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879645..880145
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMRDRAAYLQKALETLADLPQTRLLAQSSIYETAAWGKTDQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLIPLLELQPDLKLPPNHKFLRDYLAALDQSDITLFSAQQTEF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttaggcaccaatatgagggaccgagcagcttacttgcaa
aaagctcttgagactttagctgacttacctcaaacacggttgcttgctcaatcatccatt
tatgaaacggctgcttggggtaagacagatcaagctgacttccttaacatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggatcaagaactattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccttatatgactgag
cgtgcttttgttttaatccccttattggaattgcagccagatttaaaattgcctcctaat
cataagtttttaagggattaccttgcagctttagatcaatcagatatcacactcttttca
gctcaacagacagagttctag

DBGET integrated database retrieval system