KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1073Help
Entry
spyM18_1073       CDS       T00079                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    spyM18_1073
Enzymes [BR:spm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     spyM18_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(890011..891060)
Genome map
AA seq 349 aa AA seqDB search
MKAATYLSTGNLQLIDKPKPVIIKPTDAIVQLVKTTICGTDLHILGGDVPACKEGTILGH
EGIGIVKEIGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCEDGGWILGHLINGTQA
EYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKPGDNVCIVGAGPVGL
AALLTAQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKTIIDDITNGRGVDIS
MECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNITLNTGLVNANTTEML
LNVLKTGKIDATRLITHHFKLSEVEKAYETFKHAGANNALKVIIDNDIS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaacttacctttcaaccggaaatctacagctcatagacaaaccaaaacca
gtcattataaagcctacagatgctatcgtccagttggtaaaaaccactatttgtggaact
gatttgcatatcttaggtggggatgttcccgcatgtaaagaaggaacaatccttggtcat
gaaggaattggaattgttaaggagatcggtgatgcggtcactaactttaaaatcggagat
aaagtgattatttcttgcgtcacatcatgtcatacctgttattattgtaaacgaggcctt
tcgtcacattgtgaagatggcggttggattcttggccatttaattaatggaacacaagca
gaatatgtccatatcccacatgcagatggtagtctctatcatgctcctgatacgattgat
gatgaggcacttgtcatgctttctgatattttaccaacttcatatgaaattggtgtcttg
ccatcacatgtcaagcctggagataatgtttgtattgttggtgccggtccagtaggactc
gcagccttactaaccgctcaatttttctctccagccaatattattatggtcgacttatct
caaaatcgccttgaagcagctaaaacatttggagccacacacacgatttgttcaggaagt
agtgaagaagtcaagactatcattgacgatataaccaatggacgtggtgtcgatatttcc
atggagtgtgttggttatcccgcgacatttgatatttgtcaaaaaattatatcagtaggt
gggcatattgctaacgttggggttcatgggaaaccagttgatttcaacctggatgaatta
tggattaaaaatatcaccttaaacactggacttgttaatgccaatacaactgaaatgcta
ctaaatgtcttgaaaactggaaagattgacgcaacaagacttattacacatcattttaaa
ctttcagaagttgaaaaagcttatgaaacctttaaacatgctggtgcaaataacgccttg
aaagttattattgataatgatattagctaa

DBGET integrated database retrieval system