KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1546Help
Entry
spyM18_1546       CDS       T00079                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
spm00010  Glycolysis / Gluconeogenesis
spm00052  Galactose metabolism
spm00500  Starch and sucrose metabolism
spm00520  Amino sugar and nucleotide sugar metabolism
spm00521  Streptomycin biosynthesis
spm01100  Metabolic pathways
spm01110  Biosynthesis of secondary metabolites
spm01120  Microbial metabolism in diverse environments
spm01130  Biosynthesis of antibiotics
spm01200  Carbon metabolism
Module
spm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spyM18_1546
   00052 Galactose metabolism
    spyM18_1546
   00500 Starch and sucrose metabolism
    spyM18_1546
   00520 Amino sugar and nucleotide sugar metabolism
    spyM18_1546
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    spyM18_1546
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    spyM18_1546
Enzymes [BR:spm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     spyM18_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AAL98113
Position
complement(1276929..1277900)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIVASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aagcatattgttcccgatattgtagcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgctaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgtcggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ttggcagaagcttatgaaggggattcagccatcaaagcagctattgacaacggtgaaggt
gttaccagcaaagatatttttatggcagctgaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatattgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system