KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1594Help
Entry
spyM18_1594       CDS       T00079                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    spyM18_1594
  Lipid metabolism
   00600 Sphingolipid metabolism
    spyM18_1594
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    spyM18_1594
Enzymes [BR:spm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     spyM18_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1316334..1319840)
Genome map
AA seq 1168 aa AA seqDB search
MVYRQKSSEIVTRTITKPSRVTSNVKQEIDMTSDSKEQTVTGYQYHYIDQEGRKQPFNQG
WRFLMADVACAQDPSFDDSNWQVIHLPHDFSLTQPYTRNGEAESAYKLGGVGWYRHYLVL
DEVLAGCHVAITFEGSYMETEIYVNGQFIGKHLNGYQEFTYDISDVVIFGAENLLAVRVE
NKVPSSRWYSGSGLYREVSLSVLPQLHFVADQVAMTLADTAVQEKGQQKVDLRFALNQSI
QTCHYQLSLCLWEQSHCSKDKKLLYQETEVPLADLAFQRQYGLTLSLEELQLWSPDNPHL
YDLELTLYYQGQVIDCFCLETGFRQLTFTANQGLFVNGRAVKLKGVCLHHDQGGLGACAY
EDALARQLVLLKDMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDF
SNYFHQTIGTENANYLQRVRSPETSWAQYSIEAMVWSAKNDPSVLMWSIGNELMEGFSAG
VSHYPELTRQMCQWIAAIDTSRPITFGDNKLKEADFCWHEEVSQMATLLSQLDHPQGLIG
LNYANGKDYDKLHEEHSDWLLYGSETASAITSRAYYKETKKVLDSGYHLTSYDHAKVDWG
AFASQAWYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGVVGLWPSPKNAYFGILDTAG
FPKDSYYFYQSQWAQGQTTLHLLPVWQKDQLCFDEQGLVEVVVYSNAASVQLMFEDEQGN
LTDYGRKAFHTYSTPTGHTYQLYQGADAAKNPHENLYLTWRVPYQKGLLRAVAYDISGKS
IPKTSGRSQVRTYGSVAKLSWKAFEAPIDAPWELLYLDLSLLDSRGELVSHAQDWLKVQV
EGQARLLALDNGNPTDHTPYQEPLRQAYGGKLLAILALTGEAGHIKVTAKASQQLSSVFQ
TQVACRAPKEHLVTLPLEKYQFKKSRLTSQQEIGQSCLKTTQFLSVLENKDTQQKAGKVS
TPHILITSYQHYLSLPLQVCSQAFDFKKGDDIFLPQWLQVKDAQGSFVKKAFPMTWYLKE
KIFAKPILVTGYVSCFGQSIPVEARLNLAQASKRRHQDLSLVAKQSLAASQKRLTYCYQY
DTVQAIGAISFQNHTGTSLSVSVAISYGSQSSIKQETLMLADSHLSQLEEVIFFDDILTV
LYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcgccaaaagagttcagagatcgttacaaggacaattaccaagccatcaagg
gtgaccagtaacgttaaacaggagattgatatgacatcagatagcaaggagcagacagtg
actggctaccaataccactatattgatcaagaaggaagaaagcagccctttaatcaaggc
tggcgttttcttatggcagatgtggcgtgtgctcaggacccttcttttgatgattcgaac
tggcaggtgattcatttaccacatgatttcagtcttacgcagccttacacaagaaatggt
gaagctgaaagtgcttataaattaggtggtgtcggttggtatcggcattatctcgtgtta
gatgaggttttagctggttgtcatgttgccattacttttgagggttcctatatggaaacg
gaaatttatgttaatgggcaattcattggcaaacacttaaatggctatcaggaatttacc
tatgatatctctgatgtagtgatttttggagctgaaaatcttctggctgtccgggttgaa
aacaaggttcccagttctcgttggtattcaggcagtggtctttatcgtgaagtgagtttg
tctgttcttccccagcttcattttgtggcagaccaggtagcaatgaccttggctgatact
gctgtgcaggagaaagggcaacagaaagttgatttacgctttgcccttaatcagtctatt
cagacttgccactaccaattgagcctctgtttatgggaacaatcacattgctcaaaagac
aagaaactcctttatcaagaaacagaagtgcctctagctgatttggctttccaaagacag
tatggtcttacactgtctttggaagaactccaattgtggtcaccagataatcctcacctc
tacgatttagaactcactctttactatcaaggtcaggtcattgattgcttttgccttgaa
actggttttcgtcaactgacttttacggccaatcaggggctttttgtgaatggcagagct
gtcaaattaaagggagtttgtttgcatcatgaccaaggaggcctaggagcttgtgcttac
gaagatgccctagccagacaattagtcctgttgaaagacatgggggctaataccattcgt
agcacccataacccaagtagtcccaaacttaggcaactagccaatcgtctcggctttttt
gtgattgaagaagcctttgacacctggacctacgccaaaaatggaaatgttaatgacttt
tcaaactatttccatcagactatcggaactgaaaatgcaaactatcttcaaagagtgagg
tcacctgaaacgagctgggcccagtatagtattgaggccatggtctggtctgccaagaat
gacccgtcagtgttgatgtggtcgattggtaatgaattgatggaaggtttttcagccggt
gtcagtcattacccagagctgacaagacaaatgtgccaatggattgctgctattgacacc
tcacgtcccattacctttggggataataaattaaaagaagctgacttttgctggcatgaa
gaagtgtcgcaaatggcaactcttcttagtcaattagaccatccccagggactcattggg
ttaaactatgctaatggaaaagactatgataagcttcatgaggagcactctgattggctg
ttgtatggttctgaaacagcctcagccattaccagcagggcttattataaagagacaaaa
aaagttcttgactccggttatcacctaacctcttatgatcatgctaaggttgattggggt
gccttcgctagccaggcttggtatgataccattacccgtgattttgttgctggcgaatgc
gtttggacaggctttgattatttaggagaacctaccccctggaacaagatcgacagcggt
gttgtaggcctttggccttctcctaaaaatgcctactttggcattttagacacggcaggc
tttccaaaagatagctattatttttaccaaagtcagtgggcgcaggggcagaccaccttg
cacctgttaccagtctggcagaaggaccagctttgtttcgatgagcagggattggtggag
gttgtggtttatagcaatgctgccagtgtgcaactgatgtttgaagatgagcagggcaac
ttaacagattatggaaggaaggcatttcatacttatagcacgccaacgggacacacttat
cagctttaccaaggagctgacgctgctaagaatcctcacgagaacctttacctgacttgg
cgagtgccctatcaaaaagggttgctaagggcagtggcctacgacatttctggtaaaagc
attccaaaaaccagtggacgttctcaggttagaacctatggttcagtggcaaagctatct
tggaaagcctttgaagcacctattgacgctccttgggaattgctttatctggatttatca
ctcttggatagccgaggtgaattggtcagccatgctcaagattggctaaaggttcaagta
gaaggacaagcccgtttgttggctcttgataatgggaatccgactgaccacaccccttat
caggagcctctacgccaggcatatgggggaaaattattagccattttagccctcactgga
gaggcgggacacattaaggtcacggcaaaagcctcgcagcaacttagcagtgtttttcag
acacaagtagcctgccgtgcccccaaagaacacttagtgacactacctttagagaaatat
cagtttaaaaagagccgactgacaagtcaacaagaaattggtcaatcttgtctaaagacc
acacaattcctttctgttttggagaacaaagacacccagcaaaaagcaggtaaggttagc
acacctcacattcttatcaccagttaccagcactatttatctctgcccttgcaggtttgt
tctcaggcatttgattttaaaaaaggcgatgatatcttcttgcctcagtggctccaagtc
aaagatgcccaaggttcttttgtgaaaaaagcttttccaatgacatggtacctaaaagag
aaaatctttgccaagcctattcttgtcacgggctatgtttcttgttttggtcaatcaata
ccggttgaggcaaggcttaacctagcacaagctagcaaaagacggcaccaggatctcagt
ttagtcgccaagcaatccctggccgcaagtcaaaaaaggctaacttattgctaccaatat
gatacggtgcaagccataggagccattagctttcaaaatcacacaggcacatctcttagt
gtttctgtggcaatcagttatggtagtcagagctctattaagcaagaaaccttgatgcta
gctgatagccacttgagccagttagaagaggttattttcttcgatgatattttgactgtt
ttgtatctagcagtgacccttgaagtcattgaaggacctgacctaactgaagacagtatt
caaattggcctttgggatttagcatga

DBGET integrated database retrieval system