KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1645Help
Entry
spyM18_1645       CDS       T00079                                 

Gene name
atoB
Definition
(GenBank) putative acetyl-CoA:acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    spyM18_1645 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    spyM18_1645 (atoB)
   00640 Propanoate metabolism
    spyM18_1645 (atoB)
   00650 Butanoate metabolism
    spyM18_1645 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    spyM18_1645 (atoB)
   00072 Synthesis and degradation of ketone bodies
    spyM18_1645 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    spyM18_1645 (atoB)
   00310 Lysine degradation
    spyM18_1645 (atoB)
   00380 Tryptophan metabolism
    spyM18_1645 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    spyM18_1645 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    spyM18_1645 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    spyM18_1645 (atoB)
Enzymes [BR:spm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     spyM18_1645 (atoB)
Exosome [BR:spm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   spyM18_1645 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1370077..1371264
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQIAIHSGIPSDKTAFTLDMVCGSGLKAIQLATQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGAGPIPATQK
VLKKAGLTTSDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcagga
ttagggcaaaacgttgccagacagattgctattcactctggcatccctagtgataaaaca
gccttcacgcttgatatggtctgtggttcaggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacag
gcagcctatgtgtcaactcagcaccgttttggacagcgacttggtaatagtcaattgatt
gatactcttgttcatgatggattgacagatgctttcaacaattatcatatgggtatcact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagaccctttaattgttacaacagatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgccttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggagctggaccaattcctgccactcaaaaa
gtccttaagaaagctggattaacaacttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaattgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system