KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1649Help
Entry
spyM18_1649       CDS       T00079                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    spyM18_1649
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    spyM18_1649
Enzymes [BR:spm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     spyM18_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1372632..1373411
Genome map
AA seq 259 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETLLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVV
CDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYNSAKHGLIGLTKVTALEAADSGITVN
AICPGYVDTSLVRGQFEDLSKTRGIPLENVLEEVLYPLVPQKRLIDVQEIADYVSFLASD
KAKGVTGQACILDGGYTAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcggaattggaaaacaa
atcggggaaaccttattaaaagaaggtaaaacggttgttttttctgacattaatcaagaa
aaactggatcaggttgttgctgattatactaaagaaggctatgacgcttttagtgttgtg
tgcgatgtcaccaaagaagaagccatcaatgctgctattgatacggttgttgaaaaatat
ggtcgtattgatattttggttaacaacgcaggccttcaacatgttgccatgattgaagat
tttccaactgaaaaatttgaattcatgattaaaatcatgttgacagcaccatttattgcc
attaaacgtgcttttcctacaatgaaagctcaaaaacacggtcgtattattaatatggct
tctatcaatggtgtcattggttttgctggcaaatccgcctacaattcagctaagcacggc
ttgatcggtctgaccaaagtaactgccttagaagctgctgattcaggcattacggtcaat
gccatttgtcctggatatgttgacacatcactggttcgtggacagtttgaagacctttcc
aaaacaagaggtattccccttgaaaatgttcttgaagaagttctatacccacttgttcct
caaaaacgcctcattgacgttcaagaaattgcagactatgtgtctttccttgccagtgat
aaggcaaaaggtgttacaggtcaagcctgtatcttagacggtggctacactgctcaataa

DBGET integrated database retrieval system