KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1908Help
Entry
spyM18_1908       CDS       T00079                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:spm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583010..1585463
Genome map
AA seq 817 aa AA seqDB search
MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKIKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGHNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESINRGDTYVQAR
QLLDFAITLLEDARQVECDPTAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIANNIS
RLLDTPLSQSFSHDTIQTTIQAVQKDFAITYDQVQQEAITKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVNLADQMRRGILAADFRDKKADRSYFEAQAAFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQELLNPLQGQTEFLFNDTYFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYTAITRSKSKLILLGEYTAFEYAIKHEG
DKRQTYLIERFQEQSDLASSQPNQELKSKEQTSLFSNTATLEDDSQKSSSQLTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtttttacaggtactgttgatcgtatcatttttgaaaaccaggctaatttc
tttaaaattctcctccttgccattgaggatacagacagtgacattgacgactttgaaatc
attatcacaggaacgatggctgacattattgaaggagatgactacaccttttggggggaa
ttgacccagcaccctaaatacggtcaacaactcaaactaagccgttaccaaaaaatcaaa
cctagttcatctggtttggttaattatttctctagtgaccattttaaggggattggtaaa
aaaacagcggagaaaatcattgcgctatatggtcataataccattgaccatattttagaa
gacccaagcaaattagaaactatctctggcctatctaaggctaatcgtcaagcctttgtc
gctaaactaaaattgaattacggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgaaaagtataaagaagaggctcttgacctt
gttaaagaaaatccctatcagttagtcgaagatctacaaggttttgggtttaaaatggca
gatgctctcgctgaaaacttagggattgaaagcgactctccgaaacgttttcgtgcagcc
ctccttcactgtctcttggaagaatccatcaatcgaggagatacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgatcct
actgctgtggctgaacaactaagcgagttaatcatagagggcaaaatcaaaaacagtgac
accaaactgtttgatgctagcctttattttgctgaagaagggattgctaacaacatctct
cgtctcttagatacccctttaagtcagtcatttagtcatgataccattcaaacaaccatc
caagccgttcaaaaagactttgccatcacctatgaccaagtgcagcaagaagccattact
aaggccttaaccagcaaggtctttctcctaacaggtggtcccggaacaggaaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgcatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaatggggacaacgattac
caagccatggaggattatctagactgcgacttgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccagttgttaggagcgattaactcaacaactcaagtgattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtcaatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgat
aaaaaagctgaccgttcttattttgaagcccaagcagcctttatccctgacatgattcaa
aaaattgtcctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaagctggcatcaatcatcttaatcaactcatgcaagaacttctc
aatcccttgcaaggacaaacagaatttctgttcaatgatacgtattttcgtaaaggtgat
aaagtcctgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatacaccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccctggcctat
gccatgagcattcataaatcgcaagggagtgagtttcaagtggtgattttacctatcaca
cgccaaagcggccgactcttgcaacgaaatgtgatttacacggccattactcggtctaaa
agtaagttaattctgttgggagaatatactgcctttgagtatgctattaaacacgaaggc
gataaacgccaaacctacttgatcgaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagaacagacctcccttttttctaatacggcaacc
cttgaggacgactctcaaaaatcttcctctcaattaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagaatcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system