KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1960Help
Entry
spyM18_1960       CDS       T00079                                 

Gene name
rpoE
Definition
DNA-directed RNA polymerase subunit delta
Orthology
K03048  
DNA-directed RNA polymerase subunit delta
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    spyM18_1960 (rpoE)
   00240 Pyrimidine metabolism
    spyM18_1960 (rpoE)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    spyM18_1960 (rpoE)
Transcription machinery [BR:spm03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     spyM18_1960 (rpoE)
DNA repair and recombination proteins [BR:spm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      spyM18_1960 (rpoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1626908..1627483)
Genome map
AA seq 191 aa AA seqDB search
MKLDVFAGQEKSELSMIEVARAILEERGRDNEMYFSDLVNEIQNYLGKSDAGIRHALPFF
YTDLNTDGSFIPLGENKWGLRSWYAIDEIDEEIITLEEDEDGAQKRKKKRVNAFMDGDED
AIDYRDDDPEDEDFTEESAEVEYDEDDPDDEKSEVESYDSELNEIIPEDDFEEVDINEED
EEDEEDEEPVL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagacgtatttgcaggacaagaaaaaagcgagctttccatgattgaagtggcg
cgtgccattttggaagaacgcggtcgcgacaatgagatgtactttagcgatttagtcaat
gagattcaaaattacttaggaaaatctgatgcaggtattcgtcatgcattaccatttttc
tatactgacttaaatacggatggctcatttattcctctaggtgaaaacaaatggggactt
cgttcgtggtatgctattgatgaaattgatgaagaaattattactctagaagaagatgaa
gatggcgcacaaaaacgtaagaaaaaacgcgttaatgctttcatggatggagatgaagac
gctattgattatagagatgatgatccagaagatgaagatttcacagaagaatcagctgag
gttgaatatgatgaagatgatccagatgatgaaaaatcagaagtggagtcatatgattca
gaattgaatgaaattatccctgaagatgattttgaagaagttgatatcaatgaagaagac
gaagaagatgaagaagatgaagaaccagttctctaa

DBGET integrated database retrieval system