KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1960Help
Entry
spyM18_1960       CDS       T00079                                 

Gene name
rpoE
Definition
DNA-directed RNA polymerase subunit delta
Orthology
K03048  
DNA-directed RNA polymerase subunit delta
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spm00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:spm03020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1626908..1627483)
Genome map
AA seq 191 aa AA seqDB search
MKLDVFAGQEKSELSMIEVARAILEERGRDNEMYFSDLVNEIQNYLGKSDAGIRHALPFF
YTDLNTDGSFIPLGENKWGLRSWYAIDEIDEEIITLEEDEDGAQKRKKKRVNAFMDGDED
AIDYRDDDPEDEDFTEESAEVEYDEDDPDDEKSEVESYDSELNEIIPEDDFEEVDINEED
EEDEEDEEPVL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagacgtatttgcaggacaagaaaaaagcgagctttccatgattgaagtggcg
cgtgccattttggaagaacgcggtcgcgacaatgagatgtactttagcgatttagtcaat
gagattcaaaattacttaggaaaatctgatgcaggtattcgtcatgcattaccatttttc
tatactgacttaaatacggatggctcatttattcctctaggtgaaaacaaatggggactt
cgttcgtggtatgctattgatgaaattgatgaagaaattattactctagaagaagatgaa
gatggcgcacaaaaacgtaagaaaaaacgcgttaatgctttcatggatggagatgaagac
gctattgattatagagatgatgatccagaagatgaagatttcacagaagaatcagctgag
gttgaatatgatgaagatgatccagatgatgaaaaatcagaagtggagtcatatgattca
gaattgaatgaaattatccctgaagatgattttgaagaagttgatatcaatgaagaagac
gaagaagatgaagaagatgaagaaccagttctctaa

DBGET integrated database retrieval system