KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_2177Help
Entry
spyM18_2177       CDS       T00079                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:spm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825989..1826585)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTKDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGNTKARSNKAGNTQLDEAIEALLALGYKATELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacagatagtgtc
aaccaattggtaaccatttatctgcatcaagtgattcgtgaggatgctcacctgttgttt
gggtttcacacgaaagatgaaaaagatgtttttctgaaattaatttctgtatcaggtatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtaat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttataaggcaacggaattgaagaaaattcgtgccttctttgaaggaacc
tctgaaacggccgaacaatacatcaaatcagcccttaaactattaatgaaaggctag

DBGET integrated database retrieval system