KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0285Help
Entry
SP_0285           CDS       T00057                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SP_0285 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP_0285 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SP_0285 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SP_0285 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SP_0285 (adhA)
   00626 Naphthalene degradation
    SP_0285 (adhA)
Enzymes [BR:spn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SP_0285 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(262907..263926)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctattgaagaaaaagtactc
cgtccacttgaaactggggaagcacttgtagaagttgaatactgtggcgtttgccacacc
gacctccacgttgctcatggtgactttggtcaagtcccaggacgtgttcttgggcacgaa
ggtatcggtatcgttaaagagattgctccagatgtgaaaagccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaagttcctgacggacttgatccagcccaa
gcttcttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctggactcattaaagaaaaaactgatggaggagctcattcagctgtcgtaactgctgtg
tctaaagttgccttcaaccaggctgttgactccattcgtgctggtggtcgcgtcgtcgct
gttggtcttccttctgaaatgatggaactcagcatcgttaaaacagtcctcgatggaatc
caagtcatcggttctcttgtcggaactcgtaaagacttagaagaagccttccaatttggt
gcagaaggtctggtagtcccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggccaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system