KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0289Help
Entry
SP_0289           CDS       T00057                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
267571..268515
Genome map
AA seq 314 aa AA seqDB search
MSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASMLDIGGESTRPG
SSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADLVNDITGLMGDEK
MAYVVAEARAKVVIMFNPVMARPQHPSSLIFPHFGFGQTFTEKELADFETLPIEDLMVAF
FERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYPIFLGVSRKRFV
INILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHRMAVEIASAIR
LADEAENLDLKQYK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaaagccaatcatgcaaagacagttatttgcggaattatcaatgtaacccca
gactccttttcggacggtggtcaattttttgctcttgagcaggcgctccagcaggctcgt
aaattgatagcagaaggagccagtatgctagatatcggcggagaatcgactcggccggga
agtagctatgttgagatagaagaggaaatccagcgtgttgttccagtgatcaaagcgatt
cgcaaggaaagtgatgtcctcatctctattgatacttggaagagtcaagtagcagaggct
gctttggctgctggtgccgatctagtcaatgatatcactggtcttatgggtgatgagaaa
atggcttatgtggtagctgaagcgagagcgaaagtggtcatcatgtttaacccagttatg
gctcgacctcagcatcctagttcgcttatcttccctcattttggttttggtcaaaccttt
acagaaaaagagttagctgactttgaaacattgccaatcgaagacttgatggtggctttc
tttgaacgagcactagcgagagcggcagaagctggtattgcaccagaaaatatcctgttg
gatccaggaattggctttggtctgaccaagaaagaaaatctgcttcttttacgggacctg
gataaactacatcagaagggctatccaatctttctcggagtgtcgcgcaagcgatttgtc
atcaatatcctagaggagaatggttttgaagtcaatcctgagacagagcttggtttccga
aatcgggacacggcttcggctcatgtaactagtatcgctgcgagacagggtgtagaagtg
gtgcgcgtgcatgacgtagctagtcacaggatggcagttgaaattgcctctgccattcgt
ctggctgatgaagcggaaaatttagatttaaaacaatataaataa

DBGET integrated database retrieval system