KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0292Help
Entry
SP_0292           CDS       T00057                                 

Definition
bifunctional folate synthesis protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
270417..271229
Genome map
AA seq 270 aa AA seqDB search
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFEFYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactgcagattaaggatttggaaatgtttgcctatcatggtctttttcctagt
gagaaagaattggggcagaaatttgtcgtttcagccatcctatcctatgatatgaccaag
gcagctacagacttggatttaacagcctctgtccattacggagaattgtgtcagcagtgg
acgacttggtttcaggaaacgagtgaagatttgattgaaacggtagcctataaactggtg
gaacgtacctttgagttttatcctcttgtccaagaaatgaagttggaactgaaaaaacct
tgggcaccggtgcatttgtcactagatacttgctcggtaaccattcatcgccgcaagcaa
cgagcctttatcgccctaggaagcaatatgggagataaacaagcaaacttgaagcaagcc
attgacaaactgcgagctcgtggcatccatattctcaaagagtccagtgtcttagcgacg
gagccttggggtggagtggagcaggatagctttgccaatcaagtggttgaggtggaaacc
tggctaccagcacaagacttgttagaaaccttgttagccattgagtcagagctgggacgg
gtgagagaagtgcattggggacctcgtttgattgatttggacttgctctttgtggaggac
cagatcctttatacagacgacctcatattgcctcatccttacatagcggaacgccttttt
gtccttgagtccttacaggaaattgcgcctcattttatccatccgatattaaaacaaccg
atccgcaacttgtatgatgctttgaaaaaatag

DBGET integrated database retrieval system