KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0303Help
Entry
SP_0303           CDS       T00057                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
276838..278274
Genome map
AA seq 478 aa AA seqDB search
MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAREITLGVLEGKYYPNH
EAIDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNEEGLQFYDNLFDECLKN
GIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKRYKDKVKYWMTFNEINNQ
ANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAVKIGHEINPDFQIGCMIAM
CPIYPVTCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFKYWERKGISVDFTAQDKEDL
LGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNNYVKASEWEWQIDPEGLRYAL
NWFTDHYHLPLFIVENGFGAIDQVAADGMVHDDYRIEYLGAHIREMKKAVVEDGVDLMGY
TPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRSPKKSFGWYKEVISSNGESVE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttaaagatggatttttatggggtggtgctgttgctgctcatcaacttgaa
ggtggatggcaagaaggtggcaagggaattagtgttgctgatgttatgactgctggtcgt
catggagtagctcgtgaaattactttgggagttttagagggtaaatattatccaaatcat
gaggcgatagatttttatcaccgttataaagaagatatagcactttttgctgaaatggga
ttcaagtgcttccgtacctctattgcatggacacgtatctttccaaaaggtgatgagtta
gagccgaatgaagaaggattacagttttatgataatctttttgatgaatgcttaaagaat
ggtattgaacctgtcatcactctatctcattttgaaatgccttatcacttagtgaccgaa
tatggtggttggaaaaataggaaattgattgatttctttgctcgttttgcagaagtcgta
tttaaacgttacaaagataaggttaaatattggatgactttcaatgaaatcaataatcaa
gcgaattatcaggaagattttgcaccatttactaactcaggtattgtatatgaggaaggt
gataatagagaagcaattatgtatcaagcagcacattacgaattagttgcttctgcacga
gctgtaaaaattggtcatgagattaatccagattttcaaataggttgtatgattgcgatg
tgtccaatttatccagttacttgcaatcctaaggatatcttaatggcaatgaaagctatg
cagaagcgttattattttgctgatgtgcatgttttaggtaaatatcctgagcatattttc
aagtattgggaacgaaaaggtatttcagttgattttactgcccaggataaagaagattta
cttggtgggactgtagattacattggtttcagttactatatgtcctttgctatcgactct
catcgtgaaaataatccttattttgattatcttgaaacagaagatttagtgaaaaataat
tatgttaaggcttctgaatgggagtggcaaattgatccagaaggtttgcgttatgcgtta
aattggtttacagaccactatcacttaccactctttattgttgaaaatggttttggagct
atagatcaagttgcagcagatggtatggtacatgatgattatagaattgaatatctaggt
gcccatattcgtgaaatgaaaaaggctgtagttgaagatggtgttgatttaatgggttat
actccatggggatgtattgatttggtttcagctggtaccggtgaaatgcggaaacgttat
ggctttatttatgtagataaagatgataatgggaagggaagttataatcgttccccgaaa
aaatcttttggctggtataaggaagttatttcatctaacggtgaatcagtagaatag

DBGET integrated database retrieval system