KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0360Help
Entry
SP_0360           CDS       T00057                                 

Definition
UDP-N-acetylglucosamine 2-epimerase
Orthology
K01791  
UDP-N-acetylglucosamine 2-epimerase [EC:5.1.3.14]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spn00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
335260..336444
Genome map
AA seq 394 aa AA seqDB search
MKIKTDYSDIHFKDNGKLKLLIIVGTRPEIIRLSSVITKCRKYFDVILAHTGQNYDYNLN
GIFFDNLGLDTPDVYMDAVGDDLGATVGNIINTSYKLMNQIKPDALLILGDTNSCLSAIA
AKRLHIPIFHMEAGNRCKDECLPEETNRRIVDVISDVNLAYSEHARKYLHECGLPKERTY
VTGSPMAEVLHKNLSAIESSDIHERLGLKKGGYILLSAHREENIDTDKNFISLFTAINQL
AEKYNMPILYSCHPRSKKRLQESGFKLDKRVIQHEPLGFHDYNCLQMNAFVVVSDSGTLP
EESSFFTSQGYPFPAVCIRTSTERPESLDKAGFILAGIDENSLLQAVETAVSLAQDEDFG
LPVPDYVEENVSTKVVKIIQSYTGIVDKIVWRKS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaagacagattatagtgatattcactttaaagataatggcaaacttaagtta
ttgattattgtgggaacacgtccagagattatacgtctaagtagtgttatcactaaatgt
cgaaagtattttgatgttattttggcacatactggacaaaactatgattacaatttaaat
ggtattttctttgataatttagggttagacactccggacgtatacatggatgctgttgga
gatgatcttggtgctactgtagggaatattattaatacttcatacaaattgatgaatcaa
attaaaccagatgctttattgattttaggggatacaaattcttgtttatcagctattgct
gccaagcgtttacatattccaatttttcatatggaggctggcaatcgctgtaaagatgag
tgcctaccggaagagactaatcgtcggattgttgatgttatttcagatgttaacttagca
tactctgaacatgcacgtaagtatttacatgagtgtggtttacctaaagagcgcacatat
gtaactggttctcctatggcagaagtgttacataaaaatttatctgctattgagtcttca
gatatccatgaacgtttgggattgaaaaaaggaggttatatcttactttcagctcaccgt
gaggaaaatattgatacagataaaaattttatttctctctttacagcaattaatcaatta
gctgaaaagtataatatgccaatcttatattcttgccatcctagatcaaagaaaaggcta
caagagagcggttttaaactagataaacgtgtgattcagcatgagccactaggattccat
gactataattgtttacagatgaatgcatttgttgtagtatctgattcgggaactttaccg
gaagaaagtagtttctttactagtcaaggttatccttttcccgctgtatgtattcgtaca
agtacagaacgtcctgagtccttagataaggcaggatttattttggcaggcattgatgaa
aattctcttcttcaagcagttgaaactgctgttagcttggcacaagatgaggattttgga
ttaccggttccggattatgttgaggaaaatgtctctactaaagttgttaagataatacag
agctatacagggatagtggataaaatagtttggaggaaaagctga

DBGET integrated database retrieval system