KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0360Help
Entry
SP_0360           CDS       T00057                                 

Definition
UDP-N-acetylglucosamine 2-epimerase
Orthology
K01791  
UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SP_0360
Enzymes [BR:spn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.14  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing)
     SP_0360
Lipopolysaccharide biosynthesis proteins [BR:spn01005]
 Unusual sugar
  SP_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
335260..336444
Genome map
AA seq 394 aa AA seqDB search
MKIKTDYSDIHFKDNGKLKLLIIVGTRPEIIRLSSVITKCRKYFDVILAHTGQNYDYNLN
GIFFDNLGLDTPDVYMDAVGDDLGATVGNIINTSYKLMNQIKPDALLILGDTNSCLSAIA
AKRLHIPIFHMEAGNRCKDECLPEETNRRIVDVISDVNLAYSEHARKYLHECGLPKERTY
VTGSPMAEVLHKNLSAIESSDIHERLGLKKGGYILLSAHREENIDTDKNFISLFTAINQL
AEKYNMPILYSCHPRSKKRLQESGFKLDKRVIQHEPLGFHDYNCLQMNAFVVVSDSGTLP
EESSFFTSQGYPFPAVCIRTSTERPESLDKAGFILAGIDENSLLQAVETAVSLAQDEDFG
LPVPDYVEENVSTKVVKIIQSYTGIVDKIVWRKS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaagacagattatagtgatattcactttaaagataatggcaaacttaagtta
ttgattattgtgggaacacgtccagagattatacgtctaagtagtgttatcactaaatgt
cgaaagtattttgatgttattttggcacatactggacaaaactatgattacaatttaaat
ggtattttctttgataatttagggttagacactccggacgtatacatggatgctgttgga
gatgatcttggtgctactgtagggaatattattaatacttcatacaaattgatgaatcaa
attaaaccagatgctttattgattttaggggatacaaattcttgtttatcagctattgct
gccaagcgtttacatattccaatttttcatatggaggctggcaatcgctgtaaagatgag
tgcctaccggaagagactaatcgtcggattgttgatgttatttcagatgttaacttagca
tactctgaacatgcacgtaagtatttacatgagtgtggtttacctaaagagcgcacatat
gtaactggttctcctatggcagaagtgttacataaaaatttatctgctattgagtcttca
gatatccatgaacgtttgggattgaaaaaaggaggttatatcttactttcagctcaccgt
gaggaaaatattgatacagataaaaattttatttctctctttacagcaattaatcaatta
gctgaaaagtataatatgccaatcttatattcttgccatcctagatcaaagaaaaggcta
caagagagcggttttaaactagataaacgtgtgattcagcatgagccactaggattccat
gactataattgtttacagatgaatgcatttgttgtagtatctgattcgggaactttaccg
gaagaaagtagtttctttactagtcaaggttatccttttcccgctgtatgtattcgtaca
agtacagaacgtcctgagtccttagataaggcaggatttattttggcaggcattgatgaa
aattctcttcttcaagcagttgaaactgctgttagcttggcacaagatgaggattttgga
ttaccggttccggattatgttgaggaaaatgtctctactaaagttgttaagataatacag
agctatacagggatagtggataaaatagtttggaggaaaagctga

DBGET integrated database retrieval system